Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 2 (EBNA2) , partial

Product Specifications

CAS Number

9000-83-3

Gene Name

EBNA2

UniProt

Q69022

Expression Region

247-454aa

Organism

Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)

Target Sequence

SYSIPSMTLSPEPLPPPAAPAHPLPGVIYDQQALPPTPGPPWWPPVRDPTPTTQTPPTNTKQGPDQGQGRGRWRGRGRSKGRGRMHKLPEPRRPGPDTSSPSMPQLSPVVSLHQGQGPENSPTPGPSTAGPVCRVTPSATPDISPIHEPESSDSEEPPFLFPSDWYPPTLEPAELDESWEGIFETTESHSSDEENVGGPSKRPRTSTQ

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Field of Research

Others

Assay Type

In Stock Protein

Relevance

Plays a key role in the activation of the host resting B-cell and stimulation of B-cell proliferation. Acts by up-regulating the expression of viral EBNA1-6, LMP1, LMP2A and LMP2B genes, as well as several host genes including CD21, CD23 and MYC. Activates transcription by acting as an adapter molecule that binds to cellular sequence-specific DNA-binding proteins such as host CBF1, SMARCB1 and SPI1. Once EBNA2 is near promoter sites, its acidic activating domain recruits basal and activation-associated transcription factors TFIIB, TAF40, TFIIH components ERCC2 and ERCC3, and CBP in order to promote transcription. Alternatively, EBNA2 can affect activities of cell cycle regulators and retard cell cycle progression at G2/M phase. It also induces chromosomal instability, by disrupting mitotic checkpoints, multi-nucleation and formation of micronuclei in infected cells (By similarity).

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Length

Partial

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays a key role in the activation of the host resting B-cell and stimulation of B-cell proliferation. Acts by up-regulating the expression of viral EBNA1-6, LMP1, LMP2A and LMP2B genes, as well as several host genes including CD21, CD23 and MYC. Activates transcription by acting as an adapter molecule that binds to cellular sequence-specific DNA-binding proteins such as host CBF1, SMARCB1 and SPI1. Once EBNA2 is near promoter sites, its acidic activating domain recruits basal and activation-associated transcription factors TFIIB, TAF40, TFIIH components ERCC2 and ERCC3, and CBP in order to promote transcription. Alternatively, EBNA2 can affect activities of cell cycle regulators and retard cell cycle progression at G2/M phase. It also induces chromosomal instability, by disrupting mitotic checkpoints, multi-nucleation and formation of micronuclei in infected cells (By similarity).

Molecular Weight

25.9 kDa

References & Citations

"U2 region of Epstein-Barr virus DNA may encode Epstein-Barr nuclear antigen 2."Dambaugh T., Hennessy K., Chamnankit L., Kieff E.Proc. Natl. Acad. Sci. U.S.A. 81:7632-7636 (1984)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MIR569 Human MicroRNA Expression Plasmid (MI0003576)
SC400547 10 µg

MIR569 Human MicroRNA Expression Plasmid (MI0003576)

Ask
View Details
Anti-Nitric Oxide Synthase 1, Neuronal (NOS1)
FY-AB40700-01 1 mL

Anti-Nitric Oxide Synthase 1, Neuronal (NOS1)

Ask
View Details
Anti-Nitric Oxide Synthase 1, Neuronal (NOS1)
FY-AB40700-02 100 µL

Anti-Nitric Oxide Synthase 1, Neuronal (NOS1)

Ask
View Details
Anti-Nitric Oxide Synthase 1, Neuronal (NOS1)
FY-AB40700-03 200 µL

Anti-Nitric Oxide Synthase 1, Neuronal (NOS1)

Ask
View Details
TFPI2 (NM_006528) Human 3' UTR Clone
SC205663 10 µg

TFPI2 (NM_006528) Human 3' UTR Clone

Ask
View Details
DSPE-PEG-Maleimide (MW 2000)
MF-0154589-01 5 mg

DSPE-PEG-Maleimide (MW 2000)

Ask
View Details