What is the catalog number for MIP-2/CXCL2, Mouse?

The catalog number for MIP-2/CXCL2, Mouse is HY-P7258.

What sizes are available for MIP-2/CXCL2, Mouse?

MIP-2/CXCL2, Mouse is available in the following size(s): 2 µg, 10 µg, 50 µg, 100 µg.

How many pack sizes does MIP-2/CXCL2, Mouse come in?

MIP-2/CXCL2, Mouse is available in 4 different pack sizes.

Is MIP-2/CXCL2, Mouse in stock?

MIP-2/CXCL2, Mouse is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures MIP-2/CXCL2, Mouse?

MIP-2/CXCL2, Mouse is manufactured by QuantiMol.

What is the estimated delivery time for MIP-2/CXCL2, Mouse?

Estimated delivery time for MIP-2/CXCL2, Mouse is approximately 15 business day(s), depending on your location.

MIP-2/CXCL2, Mouse

CXCL2, also called Gro-beta or MIP-2, is a pro-inflammatory cytokine with chemotactic activities on neutrophils. CXCL2 is produced by activated monocytes and neutrophils and expressed at sites of inflammation. CXCL2 is involved in many immune responses including wound healing, cancer metastasis, and angiogenesis[1][2]. MIP-2/CXCL2 Protein, Mouse is produced in E. coli, and consists of 74 amino acids (A27-N100) .

Product Specifications

Product Name Alternative

MIP-2/CXCL2 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mip-2-cxcl2-protein-mouse.html

Purity

98.0

Smiles

GAVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

Molecular Formula

20310 (Gene_ID) P10889 (G27-N100) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Chaochao Q, et al. Macrophage Inflammatory Protein-2 in High Mobility Group Box 1 Secretion of Macrophage Cells Exposed to Lipopolysaccharide. Cell Physiol Biochem. 2017;42 (3) :913-928.|[2]Laila A Al-Alwan, et al. Differential roles of CXCL2 and CXCL3 and their receptors in regulating normal and asthmatic airway smooth muscle cell migration. J Immunol. 2013 Sep 1;191 (5) :2731-41.|[3]Louis M Pelus, et al. Peripheral blood stem cell mobilization: the CXCR2 ligand GRObeta rapidly mobilizes hematopoietic stem cells with enhanced engraftment properties. Exp Hematol. 2006 Aug;34 (8) :1010-20.|[4]Aimalie L Hardaway, et al. Marrow adipocyte-derived CXCL1 and CXCL2 contribute to osteolysis in metastatic prostate cancer. Clin Exp Metastasis. 2015 Apr;32 (4) :353-68.|[5]Jeongim Ha, et al. CXCL2 mediates lipopolysaccharide-induced osteoclastogenesis in RANKL-primed precursors. Cytokine. 2011 Jul;55 (1) :48-55.|[6]Yu Lu, et al. Type conversion of secretomes in a 3D TAM2 and HCC cell co-culture system and functional importance of CXCL2 in HCC. Sci Rep. 2016 Apr 27;6:24558.|[7]Sagar Paudel, et al. CXCL1 regulates neutrophil homeostasis in pneumonia-derived sepsis caused by Streptococcus pneumoniae serotype 3. Blood. 2019 Mar 21;133 (12) :1335-1345.