Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-2/CXCL2, Mouse

CXCL2, also called Gro-beta or MIP-2, is a pro-inflammatory cytokine with chemotactic activities on neutrophils. CXCL2 is produced by activated monocytes and neutrophils and expressed at sites of inflammation. CXCL2 is involved in many immune responses including wound healing, cancer metastasis, and angiogenesis[1][2]. MIP-2/CXCL2 Protein, Mouse is produced in E. coli, and consists of 74 amino acids (A27-N100) .

Product Specifications

Product Name Alternative

MIP-2/CXCL2 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mip-2-cxcl2-protein-mouse.html

Purity

98.0

Smiles

GAVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

Molecular Formula

20310 (Gene_ID) P10889 (G27-N100) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Chaochao Q, et al. Macrophage Inflammatory Protein-2 in High Mobility Group Box 1 Secretion of Macrophage Cells Exposed to Lipopolysaccharide. Cell Physiol Biochem. 2017;42 (3) :913-928.|[2]Laila A Al-Alwan, et al. Differential roles of CXCL2 and CXCL3 and their receptors in regulating normal and asthmatic airway smooth muscle cell migration. J Immunol. 2013 Sep 1;191 (5) :2731-41.|[3]Louis M Pelus, et al. Peripheral blood stem cell mobilization: the CXCR2 ligand GRObeta rapidly mobilizes hematopoietic stem cells with enhanced engraftment properties. Exp Hematol. 2006 Aug;34 (8) :1010-20.|[4]Aimalie L Hardaway, et al. Marrow adipocyte-derived CXCL1 and CXCL2 contribute to osteolysis in metastatic prostate cancer. Clin Exp Metastasis. 2015 Apr;32 (4) :353-68.|[5]Jeongim Ha, et al. CXCL2 mediates lipopolysaccharide-induced osteoclastogenesis in RANKL-primed precursors. Cytokine. 2011 Jul;55 (1) :48-55.|[6]Yu Lu, et al. Type conversion of secretomes in a 3D TAM2 and HCC cell co-culture system and functional importance of CXCL2 in HCC. Sci Rep. 2016 Apr 27;6:24558.|[7]Sagar Paudel, et al. CXCL1 regulates neutrophil homeostasis in pneumonia-derived sepsis caused by Streptococcus pneumoniae serotype 3. Blood. 2019 Mar 21;133 (12) :1335-1345.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKCA sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1721508 1.0 µg DNA

PRKCA sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
pLV3-U6-PRDX3-shRNA1-Puro Plasmid
PVT47216 2 µg

pLV3-U6-PRDX3-shRNA1-Puro Plasmid

Sign In for Pricing
View Details
Recombinant Human 3-ketoacyl-CoA thiolase, His, E.coli-500ug
QP5603-ec-500ug 500ug

Recombinant Human 3-ketoacyl-CoA thiolase, His, E.coli-500ug

Sign In for Pricing
View Details
MVK (D-3) Alexa Fluor® 680
sc-390669 AF680 200 µg/mL

MVK (D-3) Alexa Fluor® 680

Sign In for Pricing
View Details
Canine Calcitonin gene-related peptide 2 (CALCB) ELISA Kit
EIA06852Ca 1 Kit

Canine Calcitonin gene-related peptide 2 (CALCB) ELISA Kit

Sign In for Pricing
View Details
Human Galectin 1 (GAL1) ELISA Kit
MBS450968-01 48 Tests

Human Galectin 1 (GAL1) ELISA Kit

Sign In for Pricing
View Details