Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Mannose-binding protein C (Mbl2)

Product Specifications

Product Name Alternative

Mannose-binding protein C (MBP-C) (Mannan-binding protein) (Ra-reactive factor polysaccharide-binding component p28A) (RaRF p28A)

Abbreviation

Recombinant Rat Mbl2 protein

Gene Name

Mbl2

UniProt

P08661

Expression Region

19-244aa

Organism

Rattus norvegicus (Rat)

Target Sequence

ETLTEGAQSSCPVIACSSPGLNGFPGKDGHDGAKGEKGEPGQGLRGLQGPPGKVGPAGPPGNPGSKGATGPKGDRGESVEFDTTNIDLEIAALRSELRAMRKWVLLSMSENVGKKYFMSSVRRMPLNRAKALCSELQGTVATPRNAEENRAIQNVAKDVAFLGITDQRTENVFEDLTGNRVRYTNWNEGEPNNVGSGENCVVLLTNGKWNDVPCSDSFLVVCEFSD

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages (By similarity) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.0 kDa

References & Citations

"Impaired secretion of rat mannose-binding protein resulting from mutations in the collagen-like domain." Heise C.T., Nicholls J.R., Leamy C.E., Wallis R. J. Immunol. 165:1403-1409 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HECTD4 Polyclonal Antibody
orb1419359 100 µL

HECTD4 Polyclonal Antibody

Sign In for Pricing
View Details
RPL22P20 Adenovirus (Human)
41121051 1.0 mL

RPL22P20 Adenovirus (Human)

Sign In for Pricing
View Details
Sheep Pepsin C ELISA kit
GTR14674174 96 Well

Sheep Pepsin C ELISA kit

Sign In for Pricing
View Details
Lentiviral human PHTF2 shRNA (UAS) - Lentiviral human PHTF2 shRNA (UAS) (25)
GTR15162005 1 Vial

Lentiviral human PHTF2 shRNA (UAS) - Lentiviral human PHTF2 shRNA (UAS) (25)

Sign In for Pricing
View Details
CHST8 (NM_022467) Human Over-expression Lysate
E45H11715-2 20 µg

CHST8 (NM_022467) Human Over-expression Lysate

Sign In for Pricing
View Details
SEC31B Protein Lysate (Rat) with C-HA Tag
43305036 100 µg

SEC31B Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details