Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human respiratory syncytial virus Protein M2-1 (M2-1)

Product Specifications

Product Name Alternative

Envelope-associated 22 kDa protein; Transcription antitermination factor M2-1; Vp24

Abbreviation

Recombinant Human respiratory syncytial virus M2-1 protein

Gene Name

M2-1

UniProt

Q4KRW3

Expression Region

2-194aa

Organism

Human respiratory syncytial virus

Target Sequence

SRRNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRILKSMDKSIDTLSEISGAAELDRTEEYALGVVGVLESYIGSINNITKQSACVAMSKLLTELNSDDIKKLRDNEELNSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKTIKNTLDIHKSITINNPKELTVSDTNDHAKNNDTT

Tag

N-terminal 6xHis-GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

51 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD66 (CEA) (COL-1), CF594 conjugate, 0.1mg/mL
BNC940002-100 1x 100 µL

CD66 (CEA) (COL-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P34 / cdk1 (POH-1), CF640R conjugate, 0.1mg/mL
BNC400853-100 1x 100 µL

P34 / cdk1 (POH-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (C66/195), CF405S conjugate, 0.1mg/mL
BNC040195-100 1x 100 µL

CD66 (CEA) (C66/195), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SIGLEC1 / CD169 / Sialoadhesin (HSn 7D2), CF568 conjugate, 0.1mg/mL
BNC682843-100 1x 100 µL

SIGLEC1 / CD169 / Sialoadhesin (HSn 7D2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/760 + KRT7/903), CF488A conjugate, 0.1mg/mL
BNC880906-100 1x 100 µL

Cytokeratin 7 (KRT7/760 + KRT7/903), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / EMA / CD227 (Epithelial Marker) (rMUC1/960), CF568 conjugate, 0.1mg/mL
BNC680960-500 1x 500 µL

MUC1 / EMA / CD227 (Epithelial Marker) (rMUC1/960), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details