Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KDM3B, Human (Myc, His-SUMO)

KDM3B protein is a histone demethylase that mainly targets "Lys-9" of histone H3, catalyzes demethylation and produces formaldehyde and succinic acid by-products. In addition to histone modifications, KDM3B has been implicated in tumor suppressor activity, indicating its importance in cellular processes, gene expression regulation, and epigenetic modifications. KDM3B Protein, Human (Myc, His-SUMO) is the recombinant human-derived KDM3B protein, expressed by E. coli , with C-Myc, N-SUMO, N-His labeled tag.

Product Specifications

Product Name Alternative

KDM3B Protein, Human (Myc, His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kdm3b-protein-human-myc-his-sumo.html

Smiles

MPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAVNVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQGQENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFRLTQEFR

Molecular Formula

51780 (Gene_ID) Q7LBC6-1 (M1498-R1721) (Accession)

Molecular Weight

Approximately 45.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Anti-Rabbit IgG (H+L) Antibody; HRP Conjugated
MBS7135682-01 0.1 mL

Goat Anti-Rabbit IgG (H+L) Antibody; HRP Conjugated

Sign In for Pricing
View Details
Goat Anti-Rabbit IgG (H+L) Antibody; HRP Conjugated
MBS7135682-02 0.5 mL

Goat Anti-Rabbit IgG (H+L) Antibody; HRP Conjugated

Sign In for Pricing
View Details
Goat Anti-Rabbit IgG (H+L) Antibody; HRP Conjugated
MBS7135682-03 5x 0.5 mL

Goat Anti-Rabbit IgG (H+L) Antibody; HRP Conjugated

Sign In for Pricing
View Details
Romo1 Antibody
GWB-MV243I 50 µg

Romo1 Antibody

Sign In for Pricing
View Details
Prostate Secretory Protein (PSP, Beta-microseminoprotein [Precursor], Immunoglobulin Binding Factor, IGBF, PN44, Prostate Secreted Seminal Plasma Protein, Prostate Secretory Protein PSP94, PSP94, Seminal Plasma beta Inhibin) (MaxLight 490) discontinued
P9054-06D-ML490 100 µL

Prostate Secretory Protein (PSP, Beta-microseminoprotein [Precursor], Immunoglobulin Binding Factor, IGBF, PN44, Prostate Secreted Seminal Plasma Protein, Prostate Secretory Protein PSP94, PSP94, Seminal Plasma beta Inhibin) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Human PITPNB Recombinant Protein
PPT-14579 100 µg

Human PITPNB Recombinant Protein

Sign In for Pricing
View Details