Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KDM3B, Human (Myc, His-SUMO)

KDM3B protein is a histone demethylase that mainly targets "Lys-9" of histone H3, catalyzes demethylation and produces formaldehyde and succinic acid by-products. In addition to histone modifications, KDM3B has been implicated in tumor suppressor activity, indicating its importance in cellular processes, gene expression regulation, and epigenetic modifications. KDM3B Protein, Human (Myc, His-SUMO) is the recombinant human-derived KDM3B protein, expressed by E. coli , with C-Myc, N-SUMO, N-His labeled tag.

Product Specifications

Product Name Alternative

KDM3B Protein, Human (Myc, His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kdm3b-protein-human-myc-his-sumo.html

Smiles

MPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAVNVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQGQENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFRLTQEFR

Molecular Formula

51780 (Gene_ID) Q7LBC6-1 (M1498-R1721) (Accession)

Molecular Weight

Approximately 45.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Osgep (NM_133676) Mouse Tagged ORF Clone Lentiviral Particle
MR204973L4V 200 µL

Osgep (NM_133676) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Caspase 12 (CASP12) Rabbit Polyclonal Antibody
AP20655PU-N 100 µg

Caspase 12 (CASP12) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cyp2j11 ORF Vector (Mouse) (pORF)
ORF042409 1.0 µg DNA

Cyp2j11 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Pseudomonas HiVeg® Agar (For Pyocyanin)
MV119-500G 500 g

Pseudomonas HiVeg® Agar (For Pyocyanin)

Sign In for Pricing
View Details
ENTPD5 Antibody, mAb, Rabbit
A05151-100 100 µL

ENTPD5 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
RNF113B Antibody (YA8551, Mouse)
HY-P88867 1 Each

RNF113B Antibody (YA8551, Mouse)

Sign In for Pricing
View Details