Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KDM3B, Human (Myc, His-SUMO)

KDM3B protein is a histone demethylase that mainly targets "Lys-9" of histone H3, catalyzes demethylation and produces formaldehyde and succinic acid by-products. In addition to histone modifications, KDM3B has been implicated in tumor suppressor activity, indicating its importance in cellular processes, gene expression regulation, and epigenetic modifications. KDM3B Protein, Human (Myc, His-SUMO) is the recombinant human-derived KDM3B protein, expressed by E. coli , with C-Myc, N-SUMO, N-His labeled tag.

Product Specifications

Product Name Alternative

KDM3B Protein, Human (Myc, His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kdm3b-protein-human-myc-his-sumo.html

Smiles

MPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAVNVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQGQENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFRLTQEFR

Molecular Formula

51780 (Gene_ID) Q7LBC6-1 (M1498-R1721) (Accession)

Molecular Weight

Approximately 45.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Anaphase-promoting complex subunit 16 (C10orf104) ELISA Kit
MBS7236941-01 48 Well

Guinea pig Anaphase-promoting complex subunit 16 (C10orf104) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anaphase-promoting complex subunit 16 (C10orf104) ELISA Kit
MBS7236941-02 96 Well

Guinea pig Anaphase-promoting complex subunit 16 (C10orf104) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anaphase-promoting complex subunit 16 (C10orf104) ELISA Kit
MBS7236941-03 5x 96 Well

Guinea pig Anaphase-promoting complex subunit 16 (C10orf104) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anaphase-promoting complex subunit 16 (C10orf104) ELISA Kit
MBS7236941-04 10x 96 Well

Guinea pig Anaphase-promoting complex subunit 16 (C10orf104) ELISA Kit

Sign In for Pricing
View Details
CD40 (CD40 Molecule, TNF Receptor Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (AP) discontinued
244392-AP 100 µL

CD40 (CD40 Molecule, TNF Receptor Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (AP) discontinued

Sign In for Pricing
View Details
Hepatoprotective agent-1
HY-162137 1 Each

Hepatoprotective agent-1

Sign In for Pricing
View Details