Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KDM3B, Human (Myc, His-SUMO)

KDM3B protein is a histone demethylase that mainly targets "Lys-9" of histone H3, catalyzes demethylation and produces formaldehyde and succinic acid by-products. In addition to histone modifications, KDM3B has been implicated in tumor suppressor activity, indicating its importance in cellular processes, gene expression regulation, and epigenetic modifications. KDM3B Protein, Human (Myc, His-SUMO) is the recombinant human-derived KDM3B protein, expressed by E. coli , with C-Myc, N-SUMO, N-His labeled tag.

Product Specifications

Product Name Alternative

KDM3B Protein, Human (Myc, His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kdm3b-protein-human-myc-his-sumo.html

Smiles

MPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAVNVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQGQENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFRLTQEFR

Molecular Formula

51780 (Gene_ID) Q7LBC6-1 (M1498-R1721) (Accession)

Molecular Weight

Approximately 45.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Bax Antibody (3X311)
MF-0068203-01 25 µL

Anti-Bax Antibody (3X311)

Sign In for Pricing
View Details
Anti-Bax Antibody (3X311)
MF-0068203-02 50 µL

Anti-Bax Antibody (3X311)

Sign In for Pricing
View Details
Anti-Bax Antibody (3X311)
MF-0068203-03 100 µL

Anti-Bax Antibody (3X311)

Sign In for Pricing
View Details
IRAK2 Protein Vector (Human) (pPM-C-HA)
PV087864 500 ng

IRAK2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
PRDX2 (Peroxiredoxin-2, Thioredoxin Peroxidase 1, Thioredoxin-dependent Peroxide Reductase 1, Thiol-specific Antioxidant Protein, TSA, PRP, Natural Killer Cell-enhancing Factor B, NKEF-B, TDPX1, NKEFB, MGC4104) (HRP)
131749-HRP 100 µL

PRDX2 (Peroxiredoxin-2, Thioredoxin Peroxidase 1, Thioredoxin-dependent Peroxide Reductase 1, Thiol-specific Antioxidant Protein, TSA, PRP, Natural Killer Cell-enhancing Factor B, NKEF-B, TDPX1, NKEFB, MGC4104) (HRP)

Sign In for Pricing
View Details
Strn Mouse Pre-designed siRNA Set A
HY-RS22334 1 Set

Strn Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details