Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KDM3B, Human (Myc, His-SUMO)

KDM3B protein is a histone demethylase that mainly targets "Lys-9" of histone H3, catalyzes demethylation and produces formaldehyde and succinic acid by-products. In addition to histone modifications, KDM3B has been implicated in tumor suppressor activity, indicating its importance in cellular processes, gene expression regulation, and epigenetic modifications. KDM3B Protein, Human (Myc, His-SUMO) is the recombinant human-derived KDM3B protein, expressed by E. coli , with C-Myc, N-SUMO, N-His labeled tag.

Product Specifications

Product Name Alternative

KDM3B Protein, Human (Myc, His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kdm3b-protein-human-myc-his-sumo.html

Smiles

MPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAVNVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQGQENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFRLTQEFR

Molecular Formula

51780 (Gene_ID) Q7LBC6-1 (M1498-R1721) (Accession)

Molecular Weight

Approximately 45.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJC25 Human qPCR Primer Pair (NM_001015882)
HP202509 200 Reactions

DNAJC25 Human qPCR Primer Pair (NM_001015882)

Sign In for Pricing
View Details
Rabbit Polyclonal URM1 Antibody
NBP2-58447 100 µL

Rabbit Polyclonal URM1 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Cdkn2aipnl shRNA (UAS) - Lentiviral mouse Cdkn2aipnl shRNA (UAS, iRFP) (25)
GTR15301133 1 Vial

Lentiviral mouse Cdkn2aipnl shRNA (UAS) - Lentiviral mouse Cdkn2aipnl shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Recombinant STAT1 (Phospho-S727) Rabbit mAb
E38MA4396 100 µL

Recombinant STAT1 (Phospho-S727) Rabbit mAb

Sign In for Pricing
View Details
TIF1 alpha (TRIM24) (NM_015905) Human 3' UTR Clone
SC208380 10 µg

TIF1 alpha (TRIM24) (NM_015905) Human 3' UTR Clone

Sign In for Pricing
View Details
Rabbit Monoclonal BTN1A1/Butyrophilin Antibody (2151C) [PE/Cy5.5]
MAB8467PECY55 0.1 mL

Rabbit Monoclonal BTN1A1/Butyrophilin Antibody (2151C) [PE/Cy5.5]

Sign In for Pricing
View Details