Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KDM3B, Human (Myc, His-SUMO)

KDM3B protein is a histone demethylase that mainly targets "Lys-9" of histone H3, catalyzes demethylation and produces formaldehyde and succinic acid by-products. In addition to histone modifications, KDM3B has been implicated in tumor suppressor activity, indicating its importance in cellular processes, gene expression regulation, and epigenetic modifications. KDM3B Protein, Human (Myc, His-SUMO) is the recombinant human-derived KDM3B protein, expressed by E. coli , with C-Myc, N-SUMO, N-His labeled tag.

Product Specifications

Product Name Alternative

KDM3B Protein, Human (Myc, His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kdm3b-protein-human-myc-his-sumo.html

Smiles

MPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAVNVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQGQENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFRLTQEFR

Molecular Formula

51780 (Gene_ID) Q7LBC6-1 (M1498-R1721) (Accession)

Molecular Weight

Approximately 45.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM106B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV761207 1.0 µg DNA

FAM106B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mouse Lymphatic vessel endothelial hyaluronic acid receptor 1 (LYVE1) ELISA Kit
AE34696MO-01 48 Tests

Mouse Lymphatic vessel endothelial hyaluronic acid receptor 1 (LYVE1) ELISA Kit

Sign In for Pricing
View Details
Mouse Lymphatic vessel endothelial hyaluronic acid receptor 1 (LYVE1) ELISA Kit
AE34696MO-02 96 Tests

Mouse Lymphatic vessel endothelial hyaluronic acid receptor 1 (LYVE1) ELISA Kit

Sign In for Pricing
View Details
KCTD16 3'UTR Luciferase Stable Cell Line
TU011573 1.0 mL

KCTD16 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ATP6V0D1 Protein Vector (Mouse) (pPB-C-His)
PV157422 500 ng

ATP6V0D1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
OCIAD1 Protein Vector (Mouse) (pPM-C-His)
PV207633 500 ng

OCIAD1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details