Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KDM3B, Human (Myc, His-SUMO)

KDM3B protein is a histone demethylase that mainly targets "Lys-9" of histone H3, catalyzes demethylation and produces formaldehyde and succinic acid by-products. In addition to histone modifications, KDM3B has been implicated in tumor suppressor activity, indicating its importance in cellular processes, gene expression regulation, and epigenetic modifications. KDM3B Protein, Human (Myc, His-SUMO) is the recombinant human-derived KDM3B protein, expressed by E. coli , with C-Myc, N-SUMO, N-His labeled tag.

Product Specifications

Product Name Alternative

KDM3B Protein, Human (Myc, His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kdm3b-protein-human-myc-his-sumo.html

Smiles

MPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAVNVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQGQENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFRLTQEFR

Molecular Formula

51780 (Gene_ID) Q7LBC6-1 (M1498-R1721) (Accession)

Molecular Weight

Approximately 45.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1565785 3'UTR Lenti-reporter-Luc Vector
39416086 1.0 µg

RGD1565785 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Neuroligin 3 (Nlgn3) Antibody (ATTO594)
abx441072 100 µg

Neuroligin 3 (Nlgn3) Antibody (ATTO594)

Sign In for Pricing
View Details
Human Rotavirus IgG (RV IgG) ELISA Kit
abx050313 96 Tests

Human Rotavirus IgG (RV IgG) ELISA Kit

Sign In for Pricing
View Details
Human CFHR2 qPCR Primer Pair
QH15797S 200 Tests

Human CFHR2 qPCR Primer Pair

Sign In for Pricing
View Details
Proliferating Umbilical Artery Endothelial Cells (HUAEC), neonatal
203-96Wn 96 Well

Proliferating Umbilical Artery Endothelial Cells (HUAEC), neonatal

Sign In for Pricing
View Details
Mouse C-Peptide ELISA Kit
RD-C-Peptide-Mu-48Tests 48 Tests

Mouse C-Peptide ELISA Kit

Sign In for Pricing
View Details