Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KDM3B, Human (Myc, His-SUMO)

KDM3B protein is a histone demethylase that mainly targets "Lys-9" of histone H3, catalyzes demethylation and produces formaldehyde and succinic acid by-products. In addition to histone modifications, KDM3B has been implicated in tumor suppressor activity, indicating its importance in cellular processes, gene expression regulation, and epigenetic modifications. KDM3B Protein, Human (Myc, His-SUMO) is the recombinant human-derived KDM3B protein, expressed by E. coli , with C-Myc, N-SUMO, N-His labeled tag.

Product Specifications

Product Name Alternative

KDM3B Protein, Human (Myc, His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kdm3b-protein-human-myc-his-sumo.html

Smiles

MPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAVNVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQGQENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFRLTQEFR

Molecular Formula

51780 (Gene_ID) Q7LBC6-1 (M1498-R1721) (Accession)

Molecular Weight

Approximately 45.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGHA2 sgRNA CRISPR Lentivector (Human) (Target 3)
K1027004 1.0 µg DNA

IGHA2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
mmu-miR-6986-3p Primers
MPM01788 150 µL / 10 µM

mmu-miR-6986-3p Primers

Sign In for Pricing
View Details
Atxn2l sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4703403 1.0 µg DNA

Atxn2l sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Goat Endothelin 1 (ET-1) ELISA Kit
CK-bio-21329-01 48 Tests

Goat Endothelin 1 (ET-1) ELISA Kit

Sign In for Pricing
View Details
Goat Endothelin 1 (ET-1) ELISA Kit
CK-bio-21329-02 96 Tests

Goat Endothelin 1 (ET-1) ELISA Kit

Sign In for Pricing
View Details
JMJD1C Protein Vector (Mouse) (pPB-N-His)
PV192947 500 ng

JMJD1C Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details