Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KDM3B, Human (Myc, His-SUMO)

KDM3B protein is a histone demethylase that mainly targets "Lys-9" of histone H3, catalyzes demethylation and produces formaldehyde and succinic acid by-products. In addition to histone modifications, KDM3B has been implicated in tumor suppressor activity, indicating its importance in cellular processes, gene expression regulation, and epigenetic modifications. KDM3B Protein, Human (Myc, His-SUMO) is the recombinant human-derived KDM3B protein, expressed by E. coli , with C-Myc, N-SUMO, N-His labeled tag.

Product Specifications

Product Name Alternative

KDM3B Protein, Human (Myc, His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kdm3b-protein-human-myc-his-sumo.html

Smiles

MPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAVNVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQGQENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFRLTQEFR

Molecular Formula

51780 (Gene_ID) Q7LBC6-1 (M1498-R1721) (Accession)

Molecular Weight

Approximately 45.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rorc Mouse Monoclonal Antibody [Clone ID: 4F3-3C8-2B7]
TA328098 100 µg

Rorc Mouse Monoclonal Antibody [Clone ID: 4F3-3C8-2B7]

Sign In for Pricing
View Details
FIGLA ORF Vector (Human) (pORF)
20558011 1.0 µg DNA

FIGLA ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Olr1700 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV637225 1.0 µg DNA

Olr1700 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
RD-PLA2G4D-Hu-48Tests 48 Tests

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Gossypium hirsutum (Upland cotton)(Gossypium mexicanum) rpl36 Polyclonal Antibody
MBS7192709 Inquire

Rabbit anti-Gossypium hirsutum (Upland cotton)(Gossypium mexicanum) rpl36 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Mouse METTL3 Polyclonal Antibody
PMJ15401 100 μg

Anti-Mouse METTL3 Polyclonal Antibody

Sign In for Pricing
View Details