TGFBR2/TGF-beta RII, Mouse (HEK293, Fc)
TGFBR2/TGF-beta RII Protein, Mouse (HEK293, Fc), a fragment of transforming growth factor-beta receptor type 2 (TβRII), with a 6His tag at the C-terminus.
Product Specifications
Product Name Alternative
TGFBR2/TGF-beta RII Protein, Mouse (HEK293, Fc), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tgfbr2-tgf-beta-rii-protein-mouse-hek293-fc.html
Purity
98.0
Smiles
IPPHVPKSVNSDVMASDNGGAVKLPQLCKFCDVRLSTCDNQKSCMSNCSITAICEKPHEVCVAVWRKNDKNITLETVCHDPKLTYHGFTLEDAASPKCVMKEKKRAGETFFMCACNMEECNDYIIFSEEYTTSSPD
Molecular Formula
21813 (Gene_ID) Q62312-2 (I24-D159) (Accession)
Molecular Weight
55-65 kDa
References & Citations
[1]Vander Ark A, et al. TGF-β receptors: In and beyond TGF-β signaling. Cell Signal. 2018 Dec;52:112-120.|[2]Gao N, et al. Clinical Implications of TβRII Expression in Breast Cancer. PLoS One. 2015 Nov 9;10 (11) :e0141412.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400352-100 1x 100 µL
CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400495-100 1x 100 µL
SUMO-1 (SM1/495), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880843-500 1x 500 µL
CD106 / VCAM1 (VCAM1/843), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880902-500 1x 500 µL
Nucleolin (NCL/902), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942386-500 1x 500 µL
CD14 (Monocyte / Macrophage Marker) (LPSR/2386), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details