Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD40, Rhesus Macaque (HEK293, His)

CD40 Protein, a vital TNFR superfamily member, lacks conserved residue (s) crucial for feature annotation propagation, indicating unique structural attributes. This distinctiveness may influence CD40's functional interactions within the TNFR superfamily, underscoring the need for further exploration to unravel its specific roles and regulatory mechanisms in cellular signaling pathways. CD40 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD40 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

CD40 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd40-protein-rhesus-macaque-hek293-his.html

Purity

90.0

Smiles

EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCSESEFLDTWNRETRCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGLHCMSESCESCVPHRSCLPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCRPWTSCETKDLVVQQAGTNKTDVVCGPQDRQR

Molecular Formula

707749 (Gene_ID) NP_001252791.1 (E21-R193) (Accession)

Molecular Weight

Approximately 31.67 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL
BNC680039-100 1x 100 µL

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF647 conjugate, 0.1mg/mL
BNC470189-100 1x 100 µL

CD74 (BU45), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF740 conjugate, 0.1mg/mL
BNC740305-100 1x 100 µL

CD95 (B-R18), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL
BNC940017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (B22.1 + B23.1), CF405S conjugate, 0.1mg/mL
BNC041221-100 1x 100 µL

Cytokeratin 8/18 (B22.1 + B23.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vimentin (VM1170), CF405S conjugate, 0.1mg/mL
BNC041170-100 1x 100 µL

Vimentin (VM1170), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details