Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Quercus alba Major pollen allergen Que a 1, partial

Product Specifications

Product Name Alternative

Major pollen allergen Que a 1 (allergen Que a 1) (Fragment)

Abbreviation

Recombinant Quercus alba Major pollen allergen Que a 1 protein, partial

UniProt

P85126

Expression Region

1-50aa

Organism

Quercus alba (White oak)

Target Sequence

GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.4 kDa

References & Citations

"Purification and characterization of the major oak pollen allergen Que a 1 for use in component resolved diagnostics using ImmunoCAP." Moverare R., Everberg H., Carlsson R., Holtz A., Thunberg R., Olsson P., Brostedt P., Hoegbom E. Allergy 146:203-211 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF405S conjugate, 0.1mg/mL
BNC040322-500 1x 500 µL

CD3e (RIV9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL
BNC881073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
BNC040270-100 1x 100 µL

Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL
BNC680149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin A2 (E67), CF594 conjugate, 0.1mg/mL
BNC940673-500 1x 500 µL

Cyclin A2 (E67), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Catenin, beta (CTNNB1) (CTNNB1/2098), CF640R conjugate, 0.1mg/mL
BNC402098-100 1x 100 µL

Catenin, beta (CTNNB1) (CTNNB1/2098), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details