Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ras-related protein Rab-5C (RAB5C)

Product Specifications

Product Name Alternative

L1880RAB5L

Abbreviation

Recombinant Human RAB5C protein

Gene Name

RAB5C

UniProt

P51148

Expression Region

1-216aa

Organism

Homo sapiens (Human)

Target Sequence

MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Protein transport. Probably involved in vesicular traffic .

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BPOZ (ABTB1) Mouse Monoclonal Antibody [Clone ID: OTI3G8]
CF811778 100 µg

BPOZ (ABTB1) Mouse Monoclonal Antibody [Clone ID: OTI3G8]

Sign In for Pricing
View Details
Crystallin Alpha B (CPTC-CRYAB-1), CF488A conjugate, 0.1mg/mL
BNC882235-100 1x 100 µL

Crystallin Alpha B (CPTC-CRYAB-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MCM2 Mouse Monoclonal Antibody [Clone ID: OTI1G10]
CF805521 100 µg

MCM2 Mouse Monoclonal Antibody [Clone ID: OTI1G10]

Sign In for Pricing
View Details
Rpgrip1 Mouse Gene Knockout Kit (CRISPR)
KN515006 1 Kit

Rpgrip1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bacitracin F (~75%)
TRC-B106530-50MG 50 mg

Bacitracin F (~75%)

Sign In for Pricing
View Details
BCL10 (MALT-Lymphoma Marker) (151), 0.2mg/mL
BNUB1852-500 1x 500 µL

BCL10 (MALT-Lymphoma Marker) (151), 0.2mg/mL

Sign In for Pricing
View Details