Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Beta-nerve growth factor (Ngf), partial

Product Specifications

Product Name Alternative

Beta-NGF

Abbreviation

Recombinant Rat Ngf protein, partial

Gene Name

Ngf

UniProt

P25427

Expression Region

124-241aa

Organism

Rattus norvegicus (Rat)

Target Sequence

THPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLGEVNINNSVFKQYFFETKCRAPNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDDKQAAWRFIRIDTACVCVLSRKAARRG

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systs. Extracellular domain ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI.

Molecular Weight

20.1 kDa

References & Citations

Rat beta-nerve growth factor sequence and site of synthesis in the adult hippocampus.Whittemore S.R., Friedman P.L., Larhammar D.G., Persson H., Gonzalez-Carvajal M., Holets V.R.J. Neurosci. Res. 20:403-410 (1988)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lipocalin-10 Lentiviral Activation Particles (h)
sc-416014-LAC 200 µL

Lipocalin-10 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
WDR20 Rabbit Polyclonal Antibody
orb1880147-01 30 µL

WDR20 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WDR20 Rabbit Polyclonal Antibody
orb1880147-02 50 µL

WDR20 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WDR20 Rabbit Polyclonal Antibody
orb1880147-03 100 µL

WDR20 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WDR20 Rabbit Polyclonal Antibody
orb1880147-04 200 µL

WDR20 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MEKK3 Rabbit monoclonal antibody
orb2298085-01 25 µL

MEKK3 Rabbit monoclonal antibody

Sign In for Pricing
View Details