Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-epsilon, Human (His)

IFN-ε protein is a type I interferon that is critical for maintaining baseline levels of IFN-regulated genes (such as 2'-5'-oligoadenylate synthetase, IRF7, and ISG15) in the female reproductive tract. It acts as a direct mediator, providing protection against viral and bacterial genital infections. IFN-epsilon Protein, Human (His) is the recombinant human-derived IFN-epsilon protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IFN-epsilon Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-epsilon-protein-human-his.html

Purity

91.00

Smiles

LDLKLIIFQQRQVNQESLKLLNKLQTLSIQQCLPHRKNFLLPQKSLSPQQYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR

Molecular Formula

338376 (Gene_ID) Q86WN2 (L22-R208) (Accession)

Molecular Weight

Approximately 26.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pig Transglutaminase 3, Epidermal (TGM3) ELISA Kit
abx361096 96 Well

Pig Transglutaminase 3, Epidermal (TGM3) ELISA Kit

Sign In for Pricing
View Details
HBZ (HBZ2, Hemoglobin Subunit zeta, HBAZ, Hemoglobin zeta Chain, Zeta-globin) (MaxLight 650)
138010-ML650 100 µL

HBZ (HBZ2, Hemoglobin Subunit zeta, HBAZ, Hemoglobin zeta Chain, Zeta-globin) (MaxLight 650)

Sign In for Pricing
View Details
Nucleolar and spindle-associated protein 1 (NUSAP1) Chicken ELISA Kit
F4853 96 Tests

Nucleolar and spindle-associated protein 1 (NUSAP1) Chicken ELISA Kit

Sign In for Pricing
View Details
Tryptone Phosphate HiVeg® Broth
MV953-500G 500 g

Tryptone Phosphate HiVeg® Broth

Sign In for Pricing
View Details
Smox Antibody, Biotin conjugated
A35220-50UG 50 µg

Smox Antibody, Biotin conjugated

Sign In for Pricing
View Details
Human 8-Isoprostane (8-ISO) Elisa Kit
EK711007 96 Well

Human 8-Isoprostane (8-ISO) Elisa Kit

Sign In for Pricing
View Details