Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-epsilon, Human (His)

IFN-ε protein is a type I interferon that is critical for maintaining baseline levels of IFN-regulated genes (such as 2'-5'-oligoadenylate synthetase, IRF7, and ISG15) in the female reproductive tract. It acts as a direct mediator, providing protection against viral and bacterial genital infections. IFN-epsilon Protein, Human (His) is the recombinant human-derived IFN-epsilon protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IFN-epsilon Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-epsilon-protein-human-his.html

Purity

91.00

Smiles

LDLKLIIFQQRQVNQESLKLLNKLQTLSIQQCLPHRKNFLLPQKSLSPQQYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR

Molecular Formula

338376 (Gene_ID) Q86WN2 (L22-R208) (Accession)

Molecular Weight

Approximately 26.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Bovine ER Lumen Protein Retaining Receptor 1 (KDELR1) ELISA Kit
MBS9944166-01 48 Well

Bovine ER Lumen Protein Retaining Receptor 1 (KDELR1) ELISA Kit

Ask
View Details
Bovine ER Lumen Protein Retaining Receptor 1 (KDELR1) ELISA Kit
MBS9944166-02 96 Well

Bovine ER Lumen Protein Retaining Receptor 1 (KDELR1) ELISA Kit

Ask
View Details
Bovine ER Lumen Protein Retaining Receptor 1 (KDELR1) ELISA Kit
MBS9944166-03 5x 96 Well

Bovine ER Lumen Protein Retaining Receptor 1 (KDELR1) ELISA Kit

Ask
View Details
Bovine ER Lumen Protein Retaining Receptor 1 (KDELR1) ELISA Kit
MBS9944166-04 10x 96 Well

Bovine ER Lumen Protein Retaining Receptor 1 (KDELR1) ELISA Kit

Ask
View Details
SPG41 CRISPRa sgRNA lentivector (set of three targets)(Human)
45304121 3x 1.0µg DNA

SPG41 CRISPRa sgRNA lentivector (set of three targets)(Human)

Ask
View Details
E2F2 (E2F Transcription Factor 2, E2F-2) (AP)
MBS6376854-01 0.1 mL

E2F2 (E2F Transcription Factor 2, E2F-2) (AP)

Ask
View Details