Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-epsilon, Human (His)

IFN-ε protein is a type I interferon that is critical for maintaining baseline levels of IFN-regulated genes (such as 2'-5'-oligoadenylate synthetase, IRF7, and ISG15) in the female reproductive tract. It acts as a direct mediator, providing protection against viral and bacterial genital infections. IFN-epsilon Protein, Human (His) is the recombinant human-derived IFN-epsilon protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IFN-epsilon Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-epsilon-protein-human-his.html

Purity

91.00

Smiles

LDLKLIIFQQRQVNQESLKLLNKLQTLSIQQCLPHRKNFLLPQKSLSPQQYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR

Molecular Formula

338376 (Gene_ID) Q86WN2 (L22-R208) (Accession)

Molecular Weight

Approximately 26.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

WFDC1, CT (H163) (WFDC1, PS20, WAP four-disulfide core domain protein 1, Prostate stromal protein ps20, ps20 growth inhibitor) (Biotin) discontinued
043868-Biotin 200 µL

WFDC1, CT (H163) (WFDC1, PS20, WAP four-disulfide core domain protein 1, Prostate stromal protein ps20, ps20 growth inhibitor) (Biotin) discontinued

Ask
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) PLO1 Polyclonal Antibody
MBS7159270 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) PLO1 Polyclonal Antibody

Ask
View Details
RAP2C (NM_021183) Human Over-expression Lysate
LC412022 20 µg

RAP2C (NM_021183) Human Over-expression Lysate

Ask
View Details
Culture Medium for Mouse Lymphoma Cell, L5178Y Tk+- Clone [3.7.2C]
AFG-ELL-1205-01 125 mL

Culture Medium for Mouse Lymphoma Cell, L5178Y Tk+- Clone [3.7.2C]

Ask
View Details
Culture Medium for Mouse Lymphoma Cell, L5178Y Tk+- Clone [3.7.2C]
AFG-ELL-1205-02 500 mL

Culture Medium for Mouse Lymphoma Cell, L5178Y Tk+- Clone [3.7.2C]

Ask
View Details
CLECSF6 (CLEC4A) Human shRNA Lentiviral Particle (Locus ID 50856)
TL305360V 500 µL Each

CLECSF6 (CLEC4A) Human shRNA Lentiviral Particle (Locus ID 50856)

Ask
View Details