Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-epsilon, Human (His)

IFN-ε protein is a type I interferon that is critical for maintaining baseline levels of IFN-regulated genes (such as 2'-5'-oligoadenylate synthetase, IRF7, and ISG15) in the female reproductive tract. It acts as a direct mediator, providing protection against viral and bacterial genital infections. IFN-epsilon Protein, Human (His) is the recombinant human-derived IFN-epsilon protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IFN-epsilon Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-epsilon-protein-human-his.html

Purity

91.00

Smiles

LDLKLIIFQQRQVNQESLKLLNKLQTLSIQQCLPHRKNFLLPQKSLSPQQYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR

Molecular Formula

338376 (Gene_ID) Q86WN2 (L22-R208) (Accession)

Molecular Weight

Approximately 26.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Bovine Janus kinase and microtubule-interacting protein 1, JAKMIP1 ELISA Kit
MBS9319334-01 48 Well

Bovine Janus kinase and microtubule-interacting protein 1, JAKMIP1 ELISA Kit

Ask
View Details
Bovine Janus kinase and microtubule-interacting protein 1, JAKMIP1 ELISA Kit
MBS9319334-02 96 Well

Bovine Janus kinase and microtubule-interacting protein 1, JAKMIP1 ELISA Kit

Ask
View Details
Bovine Janus kinase and microtubule-interacting protein 1, JAKMIP1 ELISA Kit
MBS9319334-03 5x 96 Well

Bovine Janus kinase and microtubule-interacting protein 1, JAKMIP1 ELISA Kit

Ask
View Details
Bovine Janus kinase and microtubule-interacting protein 1, JAKMIP1 ELISA Kit
MBS9319334-04 10x 96 Well

Bovine Janus kinase and microtubule-interacting protein 1, JAKMIP1 ELISA Kit

Ask
View Details
TMM85, NT (EMC4, TMEM85, ER membrane protein complex subunit 4, Cell proliferation-inducing gene 17 protein, Transmembrane protein 85) (MaxLight 550)
MBS6356610-01 0.1 mL

TMM85, NT (EMC4, TMEM85, ER membrane protein complex subunit 4, Cell proliferation-inducing gene 17 protein, Transmembrane protein 85) (MaxLight 550)

Ask
View Details
TMM85, NT (EMC4, TMEM85, ER membrane protein complex subunit 4, Cell proliferation-inducing gene 17 protein, Transmembrane protein 85) (MaxLight 550)
MBS6356610-02 5x 0.1 mL

TMM85, NT (EMC4, TMEM85, ER membrane protein complex subunit 4, Cell proliferation-inducing gene 17 protein, Transmembrane protein 85) (MaxLight 550)

Ask
View Details