Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-epsilon, Human (His)

IFN-ε protein is a type I interferon that is critical for maintaining baseline levels of IFN-regulated genes (such as 2'-5'-oligoadenylate synthetase, IRF7, and ISG15) in the female reproductive tract. It acts as a direct mediator, providing protection against viral and bacterial genital infections. IFN-epsilon Protein, Human (His) is the recombinant human-derived IFN-epsilon protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IFN-epsilon Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-epsilon-protein-human-his.html

Purity

91.00

Smiles

LDLKLIIFQQRQVNQESLKLLNKLQTLSIQQCLPHRKNFLLPQKSLSPQQYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR

Molecular Formula

338376 (Gene_ID) Q86WN2 (L22-R208) (Accession)

Molecular Weight

Approximately 26.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (EDU-2), CF568 conjugate, 0.1mg/mL
BNC680345-500 1x 500 µL

CD4 (EDU-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL
BNC940978-100 1x 100 µL

CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL
BNC681081-100 1x 100 µL

CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF568 conjugate, 0.1mg/mL
BNC680193-500 1x 500 µL

CD86 (BU63), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF647 conjugate, 0.1mg/mL
BNC470151-500 1x 500 µL

CD11a (Cris-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL
BNC400158-500 1x 500 µL

Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details