Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pulmonary surfactant-associated protein A2 (SFTPA2), partial

Product Specifications

Product Name Alternative

PSP-A; PSPA; SP-A; SP-A2;35 kDa pulmonary surfactant-associated protein; Alveolar proteinosis protein; Collectin-5

Abbreviation

Recombinant Human SFTPA2 protein, partial

Gene Name

SFTPA2

UniProt

Q8IWL1

Expression Region

141-248aa

Organism

Homo sapiens (Human)

Target Sequence

SNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

41.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIV-1, gp41 (Human Immunodeficiency Virus 1 gp41) (MaxLight 405) discontinued
214897-ML405 100 µL

HIV-1, gp41 (Human Immunodeficiency Virus 1 gp41) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Elk4 ORF Vector (Mouse) (pORF)
ORF043837 1.0 µg DNA

Elk4 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Reagent Boro5.1,RB,gl. Rim, 75x12,0x0,5-0,6mm
1217639 1000 PCK

Reagent Boro5.1,RB,gl. Rim, 75x12,0x0,5-0,6mm

Sign In for Pricing
View Details
C1QA Rabbit Polyclonal Antibody (AP)
orb870151 100 µL

C1QA Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Rat Olfactory receptor 2T12 (OR2T12) ELISA Kit
MBS7213837-01 48 Well

Rat Olfactory receptor 2T12 (OR2T12) ELISA Kit

Sign In for Pricing
View Details
Rat Olfactory receptor 2T12 (OR2T12) ELISA Kit
MBS7213837-02 96 Well

Rat Olfactory receptor 2T12 (OR2T12) ELISA Kit

Sign In for Pricing
View Details