Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UNG, Human (His)

UNG Protein excises uracil residues from DNA, addressing misincorporation of dUMP by DNA polymerase or cytosine deamination. UNG Protein, Human (His) is the recombinant human-derived UNG protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

UNG Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ung-protein-human-gst.html

Purity

98.0

Smiles

FGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL

Molecular Formula

7374 (Gene_ID) P13051-2 (F85-L304) (Accession)

Molecular Weight

Approximately 26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pcdh11x CRISPR Activation Plasmid (m2)
sc-434151-ACT-2 20 µg

Pcdh11x CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Human Docking protein 6 ELISA Kit
MBS763770-01 48 Well

Human Docking protein 6 ELISA Kit

Sign In for Pricing
View Details
Human Docking protein 6 ELISA Kit
MBS763770-02 96 Well

Human Docking protein 6 ELISA Kit

Sign In for Pricing
View Details
Human Docking protein 6 ELISA Kit
MBS763770-03 5x 96 Well

Human Docking protein 6 ELISA Kit

Sign In for Pricing
View Details
Human Docking protein 6 ELISA Kit
MBS763770-04 10x 96 Well

Human Docking protein 6 ELISA Kit

Sign In for Pricing
View Details
Anti-DC-SIGN / CD209 Reference Antibody (INSERM anti-DC-SIGN)
E24CHA195 100 µg

Anti-DC-SIGN / CD209 Reference Antibody (INSERM anti-DC-SIGN)

Sign In for Pricing
View Details