CCR5, Mouse (P. pastoris, His)
CCR5 protein is a receptor for inflammatory CC chemokines, including CCL3/MIP-1-alpha, CCL4/MIP-1-beta, and RANTES, and plays a crucial role in signal transduction by increasing intracellular calcium levels. . It acts as a chemoattractant receptor and contributes to granulocyte lineage control and T lymphocyte migration to sites of infection. CCR5 Protein, Mouse (P. pastoris, His) is the recombinant mouse-derived CCR5 protein, expressed by P. pastoris , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
CCR5 Protein, Mouse (P. pastoris, His), Mouse, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ccr5-protein-mouse-p-pastoris-his.html
Purity
97.00
Smiles
QEFFGLNNCSSSNRLDQAMQATETLGMTHCCLNPVIYAFVGEKFRSYLSVFFRKHMVKRFCKRCSIFQQDNPDRASSVYTRSTGEHEVSTGL
Molecular Formula
12774 (Gene_ID) P51682 (Q263-L354) (Accession)
Molecular Weight
12.6 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Human Tumor suppressor p53-binding protein 1 (TP53BP1) ELISA Kit
Human Tumor suppressor p53-binding protein 1 (TP53BP1) ELISA Kit
Human Tumor suppressor p53-binding protein 1 (TP53BP1) ELISA Kit
Human Tumor suppressor p53-binding protein 1 (TP53BP1) ELISA Kit