Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APH1A, Human (Cell-Free, His, SUMO)

The APH1A protein is a noncatalytic subunit of the γ-secretase complex and is essential for the assembly of this endoprotease. The γ-secretase complex, including presenilin homodimer, nicastrin, APH1A, and PSENEN/PEN2, catalyzes the cleavage of intramembrane proteins such as Notch and APP. APH1A Protein, Human (Cell-Free, His, SUMO) is the recombinant human-derived APH1A protein, expressed by E. coli Cell-free , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

APH1A Protein, Human (Cell-Free, His, SUMO), Human, E. coli Cell-free

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/aph1a-protein-human-cf-his-sumo.html

Purity

90.00

Smiles

MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLLCKD

Molecular Formula

51107 (Gene_ID) Q96BI3 (M1-D247) (Accession)

Molecular Weight

Observed band size: Monomer: 40 kDa Dimer: 90 kDa It is speculated that the protein forms a dimeric structure.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
BNC471820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
BNC040026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF405S conjugate, 0.1mg/mL
BNC041052-100 1x 100 µL

CD3e (B-B12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL
BNC800146-500 1x 500 µL

CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL
BNC940003-500 1x 500 µL

CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/2343), CF647 conjugate, 0.1mg/mL
BNC472343-500 1x 500 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/2343), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details