Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APH1A, Human (Cell-Free, His, SUMO)

The APH1A protein is a noncatalytic subunit of the γ-secretase complex and is essential for the assembly of this endoprotease. The γ-secretase complex, including presenilin homodimer, nicastrin, APH1A, and PSENEN/PEN2, catalyzes the cleavage of intramembrane proteins such as Notch and APP. APH1A Protein, Human (Cell-Free, His, SUMO) is the recombinant human-derived APH1A protein, expressed by E. coli Cell-free , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

APH1A Protein, Human (Cell-Free, His, SUMO), Human, E. coli Cell-free

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/aph1a-protein-human-cf-his-sumo.html

Purity

90.00

Smiles

MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLLCKD

Molecular Formula

51107 (Gene_ID) Q96BI3 (M1-D247) (Accession)

Molecular Weight

Observed band size: Monomer: 40 kDa Dimer: 90 kDa It is speculated that the protein forms a dimeric structure.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tssk2 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6599104 1.0 µg DNA

Tssk2 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Human Anti-Fetal Bovine/Calf Serum (FBS /FCS) IgG ELISA Kit, 96 tests, Quantitative
710-150-FBG 1 Kit

Human Anti-Fetal Bovine/Calf Serum (FBS /FCS) IgG ELISA Kit, 96 tests, Quantitative

Sign In for Pricing
View Details
Recombinant Mouse CHL-1 Protein
E53A06624 50 µg

Recombinant Mouse CHL-1 Protein

Sign In for Pricing
View Details
GPR105 Rabbit Polyclonal Antibody (Cy3)
orb984861 100 µL

GPR105 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
LB Lennox Agar Broth
SD7006 250g

LB Lennox Agar Broth

Sign In for Pricing
View Details
Tbc1d2-set siRNA/shRNA/RNAi Lentivector (Rat)
46235096 4x 500 ng

Tbc1d2-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details