Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLT3LG, Human (CHO)

FLT3LG protein, a potent stimulator of early hematopoietic cell proliferation, activates FLT3 and synergizes with colony-stimulating factors and interleukins. As a homodimer, especially in isoform 2, it crucially promotes expansion and differentiation of hematopoietic progenitor cells. FLT3LG's collaborative signaling with other molecules underscores its significance in regulating hematopoiesis and maintaining hematopoietic system balance. FLT3LG Protein, Human (CHO) is the recombinant human-derived FLT3LG protein, expressed by CHO cells , with tag free.

Product Specifications

Product Name Alternative

FLT3LG Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/flt3lg-protein-human-cho.html

Purity

96.00

Smiles

TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPP

Molecular Formula

2323 (Gene_ID) P49771-1 (T27-P185) (Accession)

Molecular Weight

Approximately 18-22 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Li F, et al. Fms-related tyrosine kinase 3 ligand promotes proliferation of placenta amnion and chorion mesenchymal stem cells in vitro. Mol Med Rep. 2014 Jul;10 (1) :322-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL
BNC040003-500 1x 500 µL

CD45RO (UCHL-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL
BNC400149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL
BNC880040-100 1x 100 µL

CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF543 conjugate, 0.1mg/mL
BNC431050-100 1x 100 µL

CD3e (CRIS-7), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL
BNC700745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL
BNC471231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details