Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF100, Human (His)

The ZNF100 protein emerged as a potential regulator of transcriptional processes, suggesting that it may influence cellular function through gene expression control. Although the specific mechanisms and target genes are not fully understood, the multifunctional nature of ZNF100 in the field of transcriptional regulation suggests its potential impact on various cellular pathways. ZNF100 Protein, Human (His) is the recombinant human-derived ZNF100 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ZNF100 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/znf100-protein-human-his.html

Smiles

RHEMVAKPPVICSHFPQDLWAEQDIKDSFQEAILKKYGKYGHDNLQLQKGCKSVDECKVHKEHDNKLNQCLITTQSNIFQCDPSAKVFHTFSNSNRHKIRHTRKKPFK

Molecular Formula

163227 (Gene_ID) Q8IYN0 (R99-K206) (Accession)

Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

glucose 6 phosphatase, catalytic subunit (G6PC) (NM_000151) Human Over-expression Lysate
LY424901 100 µg

glucose 6 phosphatase, catalytic subunit (G6PC) (NM_000151) Human Over-expression Lysate

Sign In for Pricing
View Details
Prostate Specific Acid Phosphatase (PSAP) (PASE/4LJ), CF740 conjugate, 0.1mg/mL
BNC741473-500 1x 500 µL

Prostate Specific Acid Phosphatase (PSAP) (PASE/4LJ), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frizzled 5 (FZD5) Rabbit Polyclonal Antibody
TA376410 100 µL

Frizzled 5 (FZD5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
D-erythro-Sphingosine-13C2,D2
TRC-S681002-1MG 1 mg

D-erythro-Sphingosine-13C2,D2

Sign In for Pricing
View Details
CHIC1 (NM_001039840) Human Over-expression Lysate
LC421834 20 µg

CHIC1 (NM_001039840) Human Over-expression Lysate

Sign In for Pricing
View Details
Alox12 Mouse Gene Knockout Kit (CRISPR)
KN301155LP 1 Kit

Alox12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details