Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF100, Human (His)

The ZNF100 protein emerged as a potential regulator of transcriptional processes, suggesting that it may influence cellular function through gene expression control. Although the specific mechanisms and target genes are not fully understood, the multifunctional nature of ZNF100 in the field of transcriptional regulation suggests its potential impact on various cellular pathways. ZNF100 Protein, Human (His) is the recombinant human-derived ZNF100 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ZNF100 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/znf100-protein-human-his.html

Smiles

RHEMVAKPPVICSHFPQDLWAEQDIKDSFQEAILKKYGKYGHDNLQLQKGCKSVDECKVHKEHDNKLNQCLITTQSNIFQCDPSAKVFHTFSNSNRHKIRHTRKKPFK

Molecular Formula

163227 (Gene_ID) Q8IYN0 (R99-K206) (Accession)

Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL
BNC400437-500 1x 500 µL

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LCE6A (NM_001128600) Human Over-expression Lysate
LY426969 100 µg

LCE6A (NM_001128600) Human Over-expression Lysate

Sign In for Pricing
View Details
Myozenin 1 (MYOZ1) Mouse Monoclonal Antibody [Clone ID: OTI3B5]
CF808908 100 µg

Myozenin 1 (MYOZ1) Mouse Monoclonal Antibody [Clone ID: OTI3B5]

Sign In for Pricing
View Details
Fancd2os (NM_027633) Mouse Tagged ORF Clone
MG201578 10 µg

Fancd2os (NM_027633) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2597), CF640R conjugate, 0.1mg/mL
BNC402597-100 1x 100 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2597), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 (TNFRSF8) Mouse Monoclonal Antibody [Clone ID: 3B10]
AM06728SU-N 100 µL

CD30 (TNFRSF8) Mouse Monoclonal Antibody [Clone ID: 3B10]

Sign In for Pricing
View Details