ZNF100, Human (His)
The ZNF100 protein emerged as a potential regulator of transcriptional processes, suggesting that it may influence cellular function through gene expression control. Although the specific mechanisms and target genes are not fully understood, the multifunctional nature of ZNF100 in the field of transcriptional regulation suggests its potential impact on various cellular pathways. ZNF100 Protein, Human (His) is the recombinant human-derived ZNF100 protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
ZNF100 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/znf100-protein-human-his.html
Smiles
RHEMVAKPPVICSHFPQDLWAEQDIKDSFQEAILKKYGKYGHDNLQLQKGCKSVDECKVHKEHDNKLNQCLITTQSNIFQCDPSAKVFHTFSNSNRHKIRHTRKKPFK
Molecular Formula
163227 (Gene_ID) Q8IYN0 (R99-K206) (Accession)
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog