Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDNF, Human (HEK293)

Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs) ., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. GDNF Protein, Human (HEK293) is produced in HEK293 cells, and consists of 103 amino acids (R83-I185) .

Product Specifications

Product Name Alternative

GDNF Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdnf-protein-human-hek293.html

Purity

96.00

Smiles

RGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Molecular Formula

2668 (Gene_ID) P39905-2 (R83-I185) (Accession)

Molecular Weight

Approximately 13-18 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Alberto F Cintrón-Colón, et al. GDNF synthesis, signaling, and retrograde transport in motor neurons. Cell Tissue Res. 2020 Oct;382 (1) :47-56.|[2]Tomac A, et al. Protection and repair of the nigrostriatal dopaminergic system by GDNF in vivo. Nature.1995;373 (6512) : 335-339.|[3]Michael Meir, et al. Intestinal Epithelial Barrier Maturation by Enteric Glial Cells Is GDNF-Dependent. Int J Mol Sci. 2021 Feb 14;22 (4) :1887.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL
BNC051037-100 1x 100 µL

CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF488A conjugate, 0.1mg/mL
BNC880160-100 1x 100 µL

CD20 (B9E9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF740 conjugate, 0.1mg/mL
BNC740189-100 1x 100 µL

CD74 (BU45), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL
BNC880266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), CF647 conjugate, 0.1mg/mL
BNC472221-100 1x 100 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10/844), CF568 conjugate, 0.1mg/mL
BNC680844-100 1x 100 µL

Cytokeratin 10 (KRT10/844), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details