Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDNF, Human (HEK293)

Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs) ., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. GDNF Protein, Human (HEK293) is produced in HEK293 cells, and consists of 103 amino acids (R83-I185) .

Product Specifications

Product Name Alternative

GDNF Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdnf-protein-human-hek293.html

Purity

96.00

Smiles

RGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Molecular Formula

2668 (Gene_ID) P39905-2 (R83-I185) (Accession)

Molecular Weight

Approximately 13-18 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Alberto F Cintrón-Colón, et al. GDNF synthesis, signaling, and retrograde transport in motor neurons. Cell Tissue Res. 2020 Oct;382 (1) :47-56.|[2]Tomac A, et al. Protection and repair of the nigrostriatal dopaminergic system by GDNF in vivo. Nature.1995;373 (6512) : 335-339.|[3]Michael Meir, et al. Intestinal Epithelial Barrier Maturation by Enteric Glial Cells Is GDNF-Dependent. Int J Mol Sci. 2021 Feb 14;22 (4) :1887.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human WDFY3 Knockout HEK293T cell line
GTR15418659 1 Vial

Human WDFY3 Knockout HEK293T cell line

Sign In for Pricing
View Details
Protein lin-54 homolog (LIN54) Human ELISA Kit
G3588 96 Tests

Protein lin-54 homolog (LIN54) Human ELISA Kit

Sign In for Pricing
View Details
Krt25 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3458705 3x 1.0 µg

Krt25 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
RASGEF1A Antibody
MBS7126221-01 0.05 mL

RASGEF1A Antibody

Sign In for Pricing
View Details
RASGEF1A Antibody
MBS7126221-02 0.1 mL

RASGEF1A Antibody

Sign In for Pricing
View Details
RASGEF1A Antibody
MBS7126221-03 5x 0.1 mL

RASGEF1A Antibody

Sign In for Pricing
View Details