Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGFBP-7, Mouse (HEK293, His)

The IGFBP-7 protein has moderate affinity to bind to IGF-I and IGF-II and significantly stimulates the production of prostacyclin (PGI2) . In addition to its interaction with insulin-like growth factors, IGFBP-7 also contributes to cell adhesion, suggesting its role in adhesion-related cellular processes and potential effects on cell-matrix interactions. IGFBP-7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IGFBP-7 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IGFBP-7 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igfbp-7-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

SSSDACGPCVPASCPALPRLGCPLGETRDACGCCPVCARGEGEPCGGGAAGRGHCAPGMECVKSRKRRKGKAGAAAGGPATLAVCVCKSRYPVCGSNGITYPSGCQLRAASLRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAKVFLSCEVIGIPTPVLIWNKVKRDHSGVQRTELLPGDRENLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASAAAKITVVDALHEIPLKKGEGAQL

Molecular Formula

29817 (Gene_ID) Q61581 (S26-L281) (Accession)

Molecular Weight

Approximately 32-38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mesp2 Antibody Picoband®, HRP Conjugate
A07046-1-HRP 100 µg/Vial

Anti-Mesp2 Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
FXYD2 (NM_001127489) Human Recombinant Protein
E45H33638M5 20 µg

FXYD2 (NM_001127489) Human Recombinant Protein

Sign In for Pricing
View Details
GF Sterile Syringe Filters Diameter:25mm, pore size:0.7um
SSF250-70-GF 100 PCS/Box

GF Sterile Syringe Filters Diameter:25mm, pore size:0.7um

Sign In for Pricing
View Details
Recombinant Gracilaria tenuistipitata var. liui DNA-directed RNA polymerase subunit beta (rpoB), partial
MBS1450110 Inquire

Recombinant Gracilaria tenuistipitata var. liui DNA-directed RNA polymerase subunit beta (rpoB), partial

Sign In for Pricing
View Details
MESP1 (NM_018670) Human Tagged ORF Clone Lentiviral Particle
RC202527L4V 200 µL

MESP1 (NM_018670) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Yersinia pestis Peptide chain release factor 1 (prfA)
MBS1369073-01 0.02 mg (E-Coli)

Recombinant Yersinia pestis Peptide chain release factor 1 (prfA)

Sign In for Pricing
View Details