Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B2M/Beta-2 microglobulin, Cynomolgus (HEK293, His)

B2M protein is essential for MHC class I complex, presenting antigens and enabling immune recognition. B2M forms heterodimers with alpha chains, constituting MHC class I molecules. Its participation ensures immune system function and foreign substance recognition. B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived B2M/Beta-2 microglobulin protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b2m-beta-2-microglobulin-protein-cynomolgus-hek293-his.html

Purity

98.0

Smiles

IQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM

Molecular Formula

712428 (Gene_ID) Q6V7J5 (I21-M119) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEC24D Protein Vector (Mouse) (pPM-C-HA)
43303024 500 ng

SEC24D Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Bovine Neural cell adhesion molecule 1, NCAM1 ELISA KIT
ELI-04053b 96 Tests

Bovine Neural cell adhesion molecule 1, NCAM1 ELISA KIT

Sign In for Pricing
View Details
Olr1619 3'UTR GFP Stable Cell Line
TU264882 1.0 mL

Olr1619 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
RAD54L Protein Vector (Rat) (pPB-C-His)
PV297994 500 ng

RAD54L Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
ASS1P13 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV757673 1.0 µg DNA

ASS1P13 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Cholesterol-PEG-OH
MPL0834K Each

Cholesterol-PEG-OH

Sign In for Pricing
View Details