Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B2M/Beta-2 microglobulin, Cynomolgus (HEK293, His)

B2M protein is essential for MHC class I complex, presenting antigens and enabling immune recognition. B2M forms heterodimers with alpha chains, constituting MHC class I molecules. Its participation ensures immune system function and foreign substance recognition. B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived B2M/Beta-2 microglobulin protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b2m-beta-2-microglobulin-protein-cynomolgus-hek293-his.html

Purity

98.0

Smiles

IQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM

Molecular Formula

712428 (Gene_ID) Q6V7J5 (I21-M119) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neuropilin And Tolloid-Like 1 (NETO1) Antibody
abx019143 100 µg

Neuropilin And Tolloid-Like 1 (NETO1) Antibody

Sign In for Pricing
View Details
C7orf30 Protein Vector (Human) (pPB-N-His)
PV006790 500 ng

C7orf30 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
ADP Ribosyltransferase 4 (ART4) Antibody
abx130825-01 100 µL

ADP Ribosyltransferase 4 (ART4) Antibody

Sign In for Pricing
View Details
ADP Ribosyltransferase 4 (ART4) Antibody
abx130825-02 200 µL

ADP Ribosyltransferase 4 (ART4) Antibody

Sign In for Pricing
View Details
ADP Ribosyltransferase 4 (ART4) Antibody
abx130825-03 1 mL

ADP Ribosyltransferase 4 (ART4) Antibody

Sign In for Pricing
View Details
Stx4a Protein Lysate (Mouse) with C-HA Tag
45801034 100 µg

Stx4a Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details