Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B2M/Beta-2 microglobulin, Cynomolgus (HEK293, His)

B2M protein is essential for MHC class I complex, presenting antigens and enabling immune recognition. B2M forms heterodimers with alpha chains, constituting MHC class I molecules. Its participation ensures immune system function and foreign substance recognition. B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived B2M/Beta-2 microglobulin protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b2m-beta-2-microglobulin-protein-cynomolgus-hek293-his.html

Purity

98.0

Smiles

IQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM

Molecular Formula

712428 (Gene_ID) Q6V7J5 (I21-M119) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goralatide acetate
MF-0156482 2 mg

Goralatide acetate

Sign In for Pricing
View Details
250nm Endotoxin Free Gold Nanoparticles
GEF-250-100 100 mL

250nm Endotoxin Free Gold Nanoparticles

Sign In for Pricing
View Details
TMEM17 (NM_198276) Human Tagged Lenti ORF Clone
RC208232L2 10 µg

TMEM17 (NM_198276) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rat CD47 Antibody
GWB-C51EA2 0.25 mg

Rat CD47 Antibody

Sign In for Pricing
View Details
CTPS2 Overexpression Lysate - (Dry Ice)
NBP2-09705 0.1 mg

CTPS2 Overexpression Lysate - (Dry Ice)

Sign In for Pricing
View Details
POTEG (NM_001005356) Human Over-expression Lysate
LY423696 100 µg

POTEG (NM_001005356) Human Over-expression Lysate

Sign In for Pricing
View Details