Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B2M/Beta-2 microglobulin, Cynomolgus (HEK293, His)

B2M protein is essential for MHC class I complex, presenting antigens and enabling immune recognition. B2M forms heterodimers with alpha chains, constituting MHC class I molecules. Its participation ensures immune system function and foreign substance recognition. B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived B2M/Beta-2 microglobulin protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b2m-beta-2-microglobulin-protein-cynomolgus-hek293-his.html

Purity

98.0

Smiles

IQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM

Molecular Formula

712428 (Gene_ID) Q6V7J5 (I21-M119) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse SEMA4C (Semaphorin 4C) ELISA Kit
EK240354 96 Well

Mouse SEMA4C (Semaphorin 4C) ELISA Kit

Sign In for Pricing
View Details
Ceruloplasmin (CP) Rat ELISA Kit
C3026 96 Tests

Ceruloplasmin (CP) Rat ELISA Kit

Sign In for Pricing
View Details
Anti-CPT2 Antibody (R3G49)
RHD60601 100 μg

Anti-CPT2 Antibody (R3G49)

Sign In for Pricing
View Details
CD27/TNFRSF7 hFc Chimera, Human
Z04182-100 100 µg

CD27/TNFRSF7 hFc Chimera, Human

Sign In for Pricing
View Details
p130 Cas Antibody
MBS8509571-01 0.1 mg

p130 Cas Antibody

Sign In for Pricing
View Details
p130 Cas Antibody
MBS8509571-02 0.1 mL (AF635)

p130 Cas Antibody

Sign In for Pricing
View Details