Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B2M/Beta-2 microglobulin, Cynomolgus (HEK293, His)

B2M protein is essential for MHC class I complex, presenting antigens and enabling immune recognition. B2M forms heterodimers with alpha chains, constituting MHC class I molecules. Its participation ensures immune system function and foreign substance recognition. B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived B2M/Beta-2 microglobulin protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b2m-beta-2-microglobulin-protein-cynomolgus-hek293-his.html

Purity

98.0

Smiles

IQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM

Molecular Formula

712428 (Gene_ID) Q6V7J5 (I21-M119) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAS1 Rabbit Polyclonal Antibody
TA313912 100 µL

GAS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CRIM1 (NM_016441) Human Tagged ORF Clone Lentiviral Particle
RC211291L4V 200 µL

CRIM1 (NM_016441) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Med10 Mouse siRNA Oligo Duplex (Locus ID 28077)
SR402453 1 Kit

Med10 Mouse siRNA Oligo Duplex (Locus ID 28077)

Sign In for Pricing
View Details
D-Dimer (APC) discontinued
226901-APC 100 µL

D-Dimer (APC) discontinued

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Matrix Metalloproteinase 13 (MMP13)
MBS2164708-01 0.1 mL

PE-Linked Monoclonal Antibody to Matrix Metalloproteinase 13 (MMP13)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Matrix Metalloproteinase 13 (MMP13)
MBS2164708-02 0.2 mL

PE-Linked Monoclonal Antibody to Matrix Metalloproteinase 13 (MMP13)

Sign In for Pricing
View Details