Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B2M/Beta-2 microglobulin, Cynomolgus (HEK293, His)

B2M protein is essential for MHC class I complex, presenting antigens and enabling immune recognition. B2M forms heterodimers with alpha chains, constituting MHC class I molecules. Its participation ensures immune system function and foreign substance recognition. B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived B2M/Beta-2 microglobulin protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b2m-beta-2-microglobulin-protein-cynomolgus-hek293-his.html

Purity

98.0

Smiles

IQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM

Molecular Formula

712428 (Gene_ID) Q6V7J5 (I21-M119) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELAVL2 Rabbit Polyclonal Antibody
TA384165 100 µL

ELAVL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Syce1 (NM_001025058) Rat Tagged Lenti ORF Clone
RR211710L4 10 µg

Syce1 (NM_001025058) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Cyclin E1 (G1/S-specific Cyclin-E1, CCNE1, CCNE) (MaxLight 550)
125542-ML550 100 µL

Cyclin E1 (G1/S-specific Cyclin-E1, CCNE1, CCNE) (MaxLight 550)

Sign In for Pricing
View Details
pEnCMV-NFIL3-SV40-Neo Plasmid
PVT42549 2 µg

pEnCMV-NFIL3-SV40-Neo Plasmid

Sign In for Pricing
View Details
CLCN1 Antibody / Chloride channel protein 1 (N-Terminal Region)
F54162-0.05ML 0.05 mL

CLCN1 Antibody / Chloride channel protein 1 (N-Terminal Region)

Sign In for Pricing
View Details
APOBEC3D Antibody
MBS7128406-01 0.05 mL

APOBEC3D Antibody

Sign In for Pricing
View Details