Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B2M/Beta-2 microglobulin, Cynomolgus (HEK293, His)

B2M protein is essential for MHC class I complex, presenting antigens and enabling immune recognition. B2M forms heterodimers with alpha chains, constituting MHC class I molecules. Its participation ensures immune system function and foreign substance recognition. B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived B2M/Beta-2 microglobulin protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b2m-beta-2-microglobulin-protein-cynomolgus-hek293-his.html

Purity

98.0

Smiles

IQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM

Molecular Formula

712428 (Gene_ID) Q6V7J5 (I21-M119) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vom2r3 (NM_001099460) Rat Tagged Lenti ORF Clone
RR207388L3 10 µg

Vom2r3 (NM_001099460) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Replacement Lamp for Colorimeter 257
1211015 1 PC

Replacement Lamp for Colorimeter 257

Sign In for Pricing
View Details
Recombinant Human CXADR Protein, His Tag
32-18181-50 50 µg

Recombinant Human CXADR Protein, His Tag

Sign In for Pricing
View Details
Rabbit Polyclonal FGF14 Antibody [Alexa Fluor 700]
NBP3-00172AF700 0.1 mL

Rabbit Polyclonal FGF14 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Cd8b1 (NM_009858) Mouse Tagged ORF Clone Lentiviral Particle
MR225204L3V 200 µL

Cd8b1 (NM_009858) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MYOM2 Rabbit pAb
E47R9864 100 µL

MYOM2 Rabbit pAb

Sign In for Pricing
View Details