Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B2M/Beta-2 microglobulin, Cynomolgus (HEK293, His)

B2M protein is essential for MHC class I complex, presenting antigens and enabling immune recognition. B2M forms heterodimers with alpha chains, constituting MHC class I molecules. Its participation ensures immune system function and foreign substance recognition. B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived B2M/Beta-2 microglobulin protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b2m-beta-2-microglobulin-protein-cynomolgus-hek293-his.html

Purity

98.0

Smiles

IQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM

Molecular Formula

712428 (Gene_ID) Q6V7J5 (I21-M119) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 50 nm
cd16- 2 mL

CD16 50 nm

Sign In for Pricing
View Details
Anti-Human Factor I (FITC) (Clone: OX-21) (mouse IgG1)
MBS520291-01 0.1 mg

Anti-Human Factor I (FITC) (Clone: OX-21) (mouse IgG1)

Sign In for Pricing
View Details
Anti-Human Factor I (FITC) (Clone: OX-21) (mouse IgG1)
MBS520291-02 5x 0.1 mg

Anti-Human Factor I (FITC) (Clone: OX-21) (mouse IgG1)

Sign In for Pricing
View Details
Heparanase 1 (HPSE) Rabbit Polyclonal Antibody
TA362558 100 µL

Heparanase 1 (HPSE) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Procollagen Type 1 Rabbit Monoclonal Antibody (Capture)
E56PA1044 100 µL

Procollagen Type 1 Rabbit Monoclonal Antibody (Capture)

Sign In for Pricing
View Details
Mouse Monoclonal Herpes Simplex Virus (HSV) Antibody (T111) [Alexa Fluor 488]
NB500-476AF488 0.1 mL

Mouse Monoclonal Herpes Simplex Virus (HSV) Antibody (T111) [Alexa Fluor 488]

Sign In for Pricing
View Details