Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B2M/Beta-2 microglobulin, Cynomolgus (HEK293, His)

B2M protein is essential for MHC class I complex, presenting antigens and enabling immune recognition. B2M forms heterodimers with alpha chains, constituting MHC class I molecules. Its participation ensures immune system function and foreign substance recognition. B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived B2M/Beta-2 microglobulin protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b2m-beta-2-microglobulin-protein-cynomolgus-hek293-his.html

Purity

98.0

Smiles

IQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM

Molecular Formula

712428 (Gene_ID) Q6V7J5 (I21-M119) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lipo3 (NM_001013770) Mouse Tagged ORF Clone Lentiviral Particle
MR215142L4V 200 µL

Lipo3 (NM_001013770) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ZUFSP (ZUP1) (NM_145062) Human Tagged ORF Clone Lentiviral Particle
RC203925L4V 200 µL

ZUFSP (ZUP1) (NM_145062) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
B-Cell Leukemia / Lymphoma XL Protein
abx260480-01 10 µg

B-Cell Leukemia / Lymphoma XL Protein

Sign In for Pricing
View Details
B-Cell Leukemia / Lymphoma XL Protein
abx260480-02 50 µg

B-Cell Leukemia / Lymphoma XL Protein

Sign In for Pricing
View Details
B-Cell Leukemia / Lymphoma XL Protein
abx260480-03 1 mg

B-Cell Leukemia / Lymphoma XL Protein

Sign In for Pricing
View Details
PIRC33 Protein Vector (Human) (pPM-C-HA)
PV111276 500 ng

PIRC33 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details