Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B2M/Beta-2 microglobulin, Cynomolgus (HEK293, His)

B2M protein is essential for MHC class I complex, presenting antigens and enabling immune recognition. B2M forms heterodimers with alpha chains, constituting MHC class I molecules. Its participation ensures immune system function and foreign substance recognition. B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived B2M/Beta-2 microglobulin protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b2m-beta-2-microglobulin-protein-cynomolgus-hek293-his.html

Purity

98.0

Smiles

IQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM

Molecular Formula

712428 (Gene_ID) Q6V7J5 (I21-M119) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF736P8Y Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV756683 1.0 µg DNA

ZNF736P8Y Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Kif6 3'UTR GFP Stable Cell Line
TU160575 1.0 mL

Kif6 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
ZKSCAN3 antibody
70R-21388 50 ul

ZKSCAN3 antibody

Sign In for Pricing
View Details
LLGL2 (Lethal(2) Giant Larvae Protein Homolog 2, HGL) APC
MBS6384302-01 0.1 mL

LLGL2 (Lethal(2) Giant Larvae Protein Homolog 2, HGL) APC

Sign In for Pricing
View Details
LLGL2 (Lethal(2) Giant Larvae Protein Homolog 2, HGL) APC
MBS6384302-02 5x 0.1 mL

LLGL2 (Lethal(2) Giant Larvae Protein Homolog 2, HGL) APC

Sign In for Pricing
View Details
Mouse Monoclonal PTTG1IP Antibody (4C11)
H00000754-M04 0.1 mg

Mouse Monoclonal PTTG1IP Antibody (4C11)

Sign In for Pricing
View Details