B2M/Beta-2 microglobulin, Cynomolgus (HEK293, His)
B2M protein is essential for MHC class I complex, presenting antigens and enabling immune recognition. B2M forms heterodimers with alpha chains, constituting MHC class I molecules. Its participation ensures immune system function and foreign substance recognition. B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived B2M/Beta-2 microglobulin protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/b2m-beta-2-microglobulin-protein-cynomolgus-hek293-his.html
Purity
98.0
Smiles
IQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM
Molecular Formula
712428 (Gene_ID) Q6V7J5 (I21-M119) (Accession)
Molecular Weight
Approximately 13 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
TRNAR9 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
ENPP7, ID (ENPP7, Ectonucleotide pyrophosphatase/phosphodiesterase family member 7, Alkaline sphingomyelin phosphodiesterase, Intestinal alkaline sphingomyelinase) (Biotin)
ENPP7, ID (ENPP7, Ectonucleotide pyrophosphatase/phosphodiesterase family member 7, Alkaline sphingomyelin phosphodiesterase, Intestinal alkaline sphingomyelinase) (Biotin)
C6orf106 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
Hbxip sgRNA CRISPR Lentivector (Rat) (Target 3)