Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B2M/Beta-2 microglobulin, Cynomolgus (HEK293, His)

B2M protein is essential for MHC class I complex, presenting antigens and enabling immune recognition. B2M forms heterodimers with alpha chains, constituting MHC class I molecules. Its participation ensures immune system function and foreign substance recognition. B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived B2M/Beta-2 microglobulin protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b2m-beta-2-microglobulin-protein-cynomolgus-hek293-his.html

Purity

98.0

Smiles

IQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM

Molecular Formula

712428 (Gene_ID) Q6V7J5 (I21-M119) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM31 Human shRNA Plasmid Kit (Locus ID 203562)
TL318103 1 Kit

TMEM31 Human shRNA Plasmid Kit (Locus ID 203562)

Sign In for Pricing
View Details
Slc9a3r2 ORF Vector (Mouse) (pORF)
44301014 1.0 µg DNA

Slc9a3r2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
E2F2 Protein (N-His, Human)
P514835 100 µg

E2F2 Protein (N-His, Human)

Sign In for Pricing
View Details
Olr894 Protein Vector (Rat) (pPB-N-His)
PV291499 500 ng

Olr894 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
NMNAT3, ID (NMNAT3, Nicotinamide mononucleotide adenylyltransferase 3, Nicotinate-nucleotide adenylyltransferase 3, Pyridine nucleotide adenylyltransferase 3) (MaxLight 750)
MBS6325882-01 0.1 mL

NMNAT3, ID (NMNAT3, Nicotinamide mononucleotide adenylyltransferase 3, Nicotinate-nucleotide adenylyltransferase 3, Pyridine nucleotide adenylyltransferase 3) (MaxLight 750)

Sign In for Pricing
View Details
NMNAT3, ID (NMNAT3, Nicotinamide mononucleotide adenylyltransferase 3, Nicotinate-nucleotide adenylyltransferase 3, Pyridine nucleotide adenylyltransferase 3) (MaxLight 750)
MBS6325882-02 5x 0.1 mL

NMNAT3, ID (NMNAT3, Nicotinamide mononucleotide adenylyltransferase 3, Nicotinate-nucleotide adenylyltransferase 3, Pyridine nucleotide adenylyltransferase 3) (MaxLight 750)

Sign In for Pricing
View Details