Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B2M/Beta-2 microglobulin, Cynomolgus (HEK293, His)

B2M protein is essential for MHC class I complex, presenting antigens and enabling immune recognition. B2M forms heterodimers with alpha chains, constituting MHC class I molecules. Its participation ensures immune system function and foreign substance recognition. B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived B2M/Beta-2 microglobulin protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b2m-beta-2-microglobulin-protein-cynomolgus-hek293-his.html

Purity

98.0

Smiles

IQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM

Molecular Formula

712428 (Gene_ID) Q6V7J5 (I21-M119) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd164 3'UTR GFP Stable Cell Line
TU153453 1.0 mL

Cd164 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CENPI siRNA (Mouse)
CRN0590-01 15 nmol

CENPI siRNA (Mouse)

Sign In for Pricing
View Details
CENPI siRNA (Mouse)
CRN0590-02 30 nmol

CENPI siRNA (Mouse)

Sign In for Pricing
View Details
Rastim 30 dkv
MF-0042888-01 25 mg

Rastim 30 dkv

Sign In for Pricing
View Details
Rastim 30 dkv
MF-0042888-02 50 mg

Rastim 30 dkv

Sign In for Pricing
View Details
Rastim 30 dkv
MF-0042888-03 100 mg

Rastim 30 dkv

Sign In for Pricing
View Details