Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B2M/Beta-2 microglobulin, Cynomolgus (HEK293, His)

B2M protein is essential for MHC class I complex, presenting antigens and enabling immune recognition. B2M forms heterodimers with alpha chains, constituting MHC class I molecules. Its participation ensures immune system function and foreign substance recognition. B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived B2M/Beta-2 microglobulin protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

B2M/Beta-2 microglobulin Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b2m-beta-2-microglobulin-protein-cynomolgus-hek293-his.html

Purity

98.0

Smiles

IQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM

Molecular Formula

712428 (Gene_ID) Q6V7J5 (I21-M119) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHO (Chinese Hamster Ovary Cells) discontinued
497280 3 mg

CHO (Chinese Hamster Ovary Cells) discontinued

Sign In for Pricing
View Details
Cpm (NM_027468) Mouse Tagged ORF Clone
MR207070 10 µg

Cpm (NM_027468) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SLC7A1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV688067 1.0 µg DNA

SLC7A1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
C16orf68 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV809847 1.0 µg DNA

C16orf68 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
PPP1R12A Rabbit pAb
E45R17482N-100 100 µL

PPP1R12A Rabbit pAb

Sign In for Pricing
View Details
Bleomycin A5 Hydrochloride (Copper complex)
257225-01 5 mg

Bleomycin A5 Hydrochloride (Copper complex)

Sign In for Pricing
View Details