Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB3/CD85a, Human (HEK293, Fc)

LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, Fc) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

LILRB3/CD85a Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb3-cd85a-protein-human-hek293-fc.html

Purity

97.00

Smiles

GPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYRLDKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVNPSHRWRFTCYYYYMNTPQVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSRSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPGLGRYLE

Molecular Formula

102725035 (Gene_ID) AAI04994.1 (G24-E443) (Accession)

Molecular Weight

Approximately 90-110 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Actin, Muscle Specific (Muscle Cell Marker) (Clone : SPM160)
36-11048-100 100 µg

Monoclonal Antibody to Actin, Muscle Specific (Muscle Cell Marker) (Clone : SPM160)

Sign In for Pricing
View Details
Recombinant Human Protein-arginine deiminase type-3 (PADI3)
CSB-MP891552HU-01 20 µg

Recombinant Human Protein-arginine deiminase type-3 (PADI3)

Sign In for Pricing
View Details
Recombinant Human Protein-arginine deiminase type-3 (PADI3)
CSB-MP891552HU-02 100 µg

Recombinant Human Protein-arginine deiminase type-3 (PADI3)

Sign In for Pricing
View Details
Recombinant Human Protein-arginine deiminase type-3 (PADI3)
CSB-MP891552HU-03 1 mg

Recombinant Human Protein-arginine deiminase type-3 (PADI3)

Sign In for Pricing
View Details
DODMA
MPL0909K Each

DODMA

Sign In for Pricing
View Details
1700121N20Rik Mouse siRNA Oligo Duplex (Locus ID 76639)
SR400349 1 Kit

1700121N20Rik Mouse siRNA Oligo Duplex (Locus ID 76639)

Sign In for Pricing
View Details