Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPE, Human (His)

The RPE Protein is responsible for catalyzing the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate. RPE Protein, Human (His) is the recombinant human-derived RPE protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RPE Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rpe-protein-human-his.html

Purity

98.0

Smiles

MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDR

Molecular Formula

6120 (Gene_ID) Q96AT9-1 (M1-R228) (Accession)

Molecular Weight

26-28 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Kidney
CR560774 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
Human CYP2A7 activation kit by CRISPRa
GA101094 1 Kit

Human CYP2A7 activation kit by CRISPRa

Sign In for Pricing
View Details
Rupintrivir-d4
TRC-R701702-2.5MG 2.5 mg

Rupintrivir-d4

Sign In for Pricing
View Details
MIR3662 Human qPCR Primer Pair (MI0016063)
HP300843 200 Reactions

MIR3662 Human qPCR Primer Pair (MI0016063)

Sign In for Pricing
View Details
Alms1 Mouse Gene Knockout Kit (CRISPR)
KN501154 1 Kit

Alms1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Pancreas
CS510821 5x 5 µm

Frozen Tissue Sections, Pancreas

Sign In for Pricing
View Details