Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPE, Human (His)

The RPE Protein is responsible for catalyzing the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate. RPE Protein, Human (His) is the recombinant human-derived RPE protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RPE Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rpe-protein-human-his.html

Purity

98.0

Smiles

MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDR

Molecular Formula

6120 (Gene_ID) Q96AT9-1 (M1-R228) (Accession)

Molecular Weight

26-28 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UXT Rabbit Polyclonal Antibody
TA342539 100 µL

UXT Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ESAT siRNA Oligos set (Human)
19487171 3x 5 nmol

ESAT siRNA Oligos set (Human)

Sign In for Pricing
View Details
Sodium acetate trihydrate 3.0M
40121171-1 100 mL

Sodium acetate trihydrate 3.0M

Sign In for Pricing
View Details
Cofilin 1, Non Muscle (CFL1) Antibody
abx171824-01 100 µL

Cofilin 1, Non Muscle (CFL1) Antibody

Sign In for Pricing
View Details
Cofilin 1, Non Muscle (CFL1) Antibody
abx171824-02 200 µL

Cofilin 1, Non Muscle (CFL1) Antibody

Sign In for Pricing
View Details
Cofilin 1, Non Muscle (CFL1) Antibody
abx171824-03 1 mL

Cofilin 1, Non Muscle (CFL1) Antibody

Sign In for Pricing
View Details