Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD20/MS4A1, Cynomolgus (85a.a, HEK293, His)

CD20/MS4A1 protein is a B lymphocyte membrane protein that plays a crucial regulatory role in cellular calcium influx, which is essential for the development, differentiation and activation of B lymphocytes. As part of a store-operated calcium (SOC) channel, it promotes calcium influx upon B cell receptor/BCR activation. CD20/MS4A1 Protein, Cynomolgus (85a.a, HEK293, His) is the recombinant cynomolgus-derived CD20/MS4A1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD20/MS4A1 Protein, Cynomolgus (85a.a, HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd20-ms4a1-protein-cynomolgus-85a-a-hek293-his.html

Purity

95.0

Smiles

ENEWRRTCSRPKSSVVLLSAEEKKEQVIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP

Molecular Formula

102118491 (Gene_ID) NP_001274241 (E213-P297) (Accession)

Molecular Weight

22.66 & 24.28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACSBG2 Human Over-expression Lysate
orb1371586 20 µg

ACSBG2 Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Lolium perenne NAD (P) H-quinone oxidoreductase subunit 6, chloroplastic
orb2919811-01 20 µg

Recombinant Lolium perenne NAD (P) H-quinone oxidoreductase subunit 6, chloroplastic

Sign In for Pricing
View Details
Recombinant Lolium perenne NAD (P) H-quinone oxidoreductase subunit 6, chloroplastic
orb2919811-02 100 µg

Recombinant Lolium perenne NAD (P) H-quinone oxidoreductase subunit 6, chloroplastic

Sign In for Pricing
View Details
PSIP1 (h2) : 293T Lysate
sc-117262 100 µg - 200 µL

PSIP1 (h2) : 293T Lysate

Sign In for Pricing
View Details
Mouse Eno1 Pre-designed siRNA Set A
SI104300A 1 Each

Mouse Eno1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Polyclonal CD4 Antibody
APR00383G 0.05ml

Polyclonal CD4 Antibody

Sign In for Pricing
View Details