AQP4, Human (His)
The AQP4 protein forms water-specific channels and is involved in brain water balance and solute transport. AQP4 Protein, Human (His) is the recombinant human-derived AQP4, expressed by E. coli, with N-6*His labeled tag. The total length of AQP4 Protein, Human (His) is 71 a.a..
Product Specifications
Product Name Alternative
AQP4 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/aqp4-protein-human-his.html
Purity
90.60
Smiles
CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Molecular Formula
361 (Gene_ID) P55087-1 (C253-V323) (Accession)
Molecular Weight
Approximately 16 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB1783-100 1x 100 µL
CD45RB (B-Cell Marker) (PTPRC/1783R), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
GP-2701-10 1 mL
Colloidal Gold Conjugated Pisum sativum Lectin (Garden Pea) -PEA, PSA-, 10nm
Sign In for Pricing
View Details 
RDR-FGF21-p-01 96 Tests
Porcine Fibroblast Growth Factor 21 (FGF21) ELISA Kit
Sign In for Pricing
View Details