Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AQP4, Human (His)

The AQP4 protein forms water-specific channels and is involved in brain water balance and solute transport. AQP4 Protein, Human (His) is the recombinant human-derived AQP4, expressed by E. coli, with N-6*His labeled tag. The total length of AQP4 Protein, Human (His) is 71 a.a..

Product Specifications

Product Name Alternative

AQP4 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/aqp4-protein-human-his.html

Purity

90.60

Smiles

CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV

Molecular Formula

361 (Gene_ID) P55087-1 (C253-V323) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAMKK2 (N-term) Rabbit Polyclonal Antibody
AP13738PU-N 400 µL

CAMKK2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Allocryptopine
TRC-A545070-50MG 50 mg

Allocryptopine

Sign In for Pricing
View Details
XAGE3 (NM_130776) Human Recombinant Protein
TP309351 20 µg

XAGE3 (NM_130776) Human Recombinant Protein

Sign In for Pricing
View Details
EIF3D Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G10]
TA808188AM 100 µL

EIF3D Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G10]

Sign In for Pricing
View Details
CD20 (MS4A1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A4]
TA800489BM 100 µL

CD20 (MS4A1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A4]

Sign In for Pricing
View Details
Desamino-hydroxy Revefenacin Ammonium Salt
TRC-D120890-25MG 25 mg

Desamino-hydroxy Revefenacin Ammonium Salt

Sign In for Pricing
View Details