Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AQP4, Human (His)

The AQP4 protein forms water-specific channels and is involved in brain water balance and solute transport. AQP4 Protein, Human (His) is the recombinant human-derived AQP4, expressed by E. coli, with N-6*His labeled tag. The total length of AQP4 Protein, Human (His) is 71 a.a..

Product Specifications

Product Name Alternative

AQP4 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/aqp4-protein-human-his.html

Purity

90.60

Smiles

CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV

Molecular Formula

361 (Gene_ID) P55087-1 (C253-V323) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human KCTD16 sgRNA gene knockout kit - Lentiviral human KCTD16 sgRNA gene knockout kit (25)
GTR15367017 1 Vial

Lentiviral human KCTD16 sgRNA gene knockout kit - Lentiviral human KCTD16 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Kndc1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4078404 1.0 µg DNA

Kndc1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
C1QL1 3'UTR GFP Stable Cell Line
TU052145 1.0 mL

C1QL1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
AFP-RFP (Puro) Lentivirus
LVP1034-P 1x 10^7 IFU/mL - 200 μL

AFP-RFP (Puro) Lentivirus

Sign In for Pricing
View Details
DHRS7 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-8262R-BF680 100 µL

DHRS7 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
KREMEN1 (NM_001039571) Human Over-expression Lysate
LY422074 100 µg

KREMEN1 (NM_001039571) Human Over-expression Lysate

Sign In for Pricing
View Details