Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6AP2, Human (His-SUMO)

The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His-SUMO) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

ATP6AP2 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp6ap2-protein-human-his-sumo.html

Purity

90.0

Smiles

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Molecular Formula

10159 (Gene_ID) O75787 (N17-D350) (Accession)

Molecular Weight

Approximately 53.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Phospholipase A2,PLA2G1B ELISA KIT
ELI-02053Ra 96 Tests

Rabbit Phospholipase A2,PLA2G1B ELISA KIT

Sign In for Pricing
View Details
Syntenin (SDCBP) (NM_005625) Human Mass Spec Standard
PH315390 10 µg

Syntenin (SDCBP) (NM_005625) Human Mass Spec Standard

Sign In for Pricing
View Details
Neural Cell Adhesion Molecule 1 Rabbit Monoclonal Antibody [KD Validation]
E51K2960 40 µL

Neural Cell Adhesion Molecule 1 Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
Human CCDC121 Pre-designed siRNA Set A
SI002297A 1 Each

Human CCDC121 Pre-designed siRNA Set A

Sign In for Pricing
View Details
LMF1 Protein Vector (Mouse) (pPB-N-His)
PV196927 500 ng

LMF1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Hamster Anterior Gradient Homolog 2 ELISA Kit
MBS005551-01 48 Well

Hamster Anterior Gradient Homolog 2 ELISA Kit

Sign In for Pricing
View Details