Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6AP2, Human (His-SUMO)

The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His-SUMO) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

ATP6AP2 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp6ap2-protein-human-his-sumo.html

Purity

90.0

Smiles

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Molecular Formula

10159 (Gene_ID) O75787 (N17-D350) (Accession)

Molecular Weight

Approximately 53.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CXorf61 protein, His-tagged
CXorf61-2650H 25 µg

Recombinant Human CXorf61 protein, His-tagged

Sign In for Pricing
View Details
ZFYVE16 (Zinc Finger, FYVE Domain Containing 16, DKFZp686E13162, ENDOFIN, KIAA0305)
253598 100 µL

ZFYVE16 (Zinc Finger, FYVE Domain Containing 16, DKFZp686E13162, ENDOFIN, KIAA0305)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to 4-Hydroxyphenylpyruvate Dioxygenase (HPD)
MBS2151346-01 0.1 mL

APC_Cy7-Linked Monoclonal Antibody to 4-Hydroxyphenylpyruvate Dioxygenase (HPD)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to 4-Hydroxyphenylpyruvate Dioxygenase (HPD)
MBS2151346-02 0.2 mL

APC_Cy7-Linked Monoclonal Antibody to 4-Hydroxyphenylpyruvate Dioxygenase (HPD)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to 4-Hydroxyphenylpyruvate Dioxygenase (HPD)
MBS2151346-03 0.5 mL

APC_Cy7-Linked Monoclonal Antibody to 4-Hydroxyphenylpyruvate Dioxygenase (HPD)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to 4-Hydroxyphenylpyruvate Dioxygenase (HPD)
MBS2151346-04 1 mL

APC_Cy7-Linked Monoclonal Antibody to 4-Hydroxyphenylpyruvate Dioxygenase (HPD)

Sign In for Pricing
View Details