Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6AP2, Human (His-SUMO)

The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His-SUMO) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

ATP6AP2 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp6ap2-protein-human-his-sumo.html

Purity

90.0

Smiles

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Molecular Formula

10159 (Gene_ID) O75787 (N17-D350) (Accession)

Molecular Weight

Approximately 53.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VDAC Loading Control Antibody
A0033-001 100 µL

VDAC Loading Control Antibody

Sign In for Pricing
View Details
Parainfluenza Virus Type 3 (Human Parainfluenza 3 Virus, Human Parainfluenza Virus Type 3, hPIV3, HPIV-3, PIV3) (HRP) discontinued
P3107-22J-HRP 100 µL

Parainfluenza Virus Type 3 (Human Parainfluenza 3 Virus, Human Parainfluenza Virus Type 3, hPIV3, HPIV-3, PIV3) (HRP) discontinued

Sign In for Pricing
View Details
ALDH7A1 (NM_001202404) Human Tagged ORF Clone
RC232871 10 µg

ALDH7A1 (NM_001202404) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human Annexin A3 (ANXA3) ELISA Kit
MBS2021972-01 24 Strip Well

Human Annexin A3 (ANXA3) ELISA Kit

Sign In for Pricing
View Details
Human Annexin A3 (ANXA3) ELISA Kit
MBS2021972-02 48 Well

Human Annexin A3 (ANXA3) ELISA Kit

Sign In for Pricing
View Details
Human Annexin A3 (ANXA3) ELISA Kit
MBS2021972-03 96 Well

Human Annexin A3 (ANXA3) ELISA Kit

Sign In for Pricing
View Details