Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6AP2, Human (His-SUMO)

The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His-SUMO) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

ATP6AP2 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp6ap2-protein-human-his-sumo.html

Purity

90.0

Smiles

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Molecular Formula

10159 (Gene_ID) O75787 (N17-D350) (Accession)

Molecular Weight

Approximately 53.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Brucella Suis pncB Protein (strain 1330) (aa 1-434)
VAng-Lsx5706-50gEcoli 50 µg (E. coli)

Recombinant Brucella Suis pncB Protein (strain 1330) (aa 1-434)

Sign In for Pricing
View Details
Lentiviral mouse Cdh13 shRNA (UAS) - Lentiviral mouse Cdh13 shRNA (UAS) (100)
GTR15202998 1 Vial

Lentiviral mouse Cdh13 shRNA (UAS) - Lentiviral mouse Cdh13 shRNA (UAS) (100)

Sign In for Pricing
View Details
Rabbit Monoclonal F4/80 Antibody (Cl:A3-1 (recombinant version)) [Biotin]
NBP2-81029B 0.1 mL

Rabbit Monoclonal F4/80 Antibody (Cl:A3-1 (recombinant version)) [Biotin]

Sign In for Pricing
View Details
Peptide B (Bovine)
MBS8246912-01 1 mg

Peptide B (Bovine)

Sign In for Pricing
View Details
Peptide B (Bovine)
MBS8246912-02 5 mg

Peptide B (Bovine)

Sign In for Pricing
View Details
Peptide B (Bovine)
MBS8246912-03 10 mg

Peptide B (Bovine)

Sign In for Pricing
View Details