Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6AP2, Human (His-SUMO)

The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His-SUMO) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

ATP6AP2 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp6ap2-protein-human-his-sumo.html

Purity

90.0

Smiles

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Molecular Formula

10159 (Gene_ID) O75787 (N17-D350) (Accession)

Molecular Weight

Approximately 53.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat FGF23 PicoKine ELISA Kit
MBS1751556-01 96 Well

Rat FGF23 PicoKine ELISA Kit

Sign In for Pricing
View Details
Rat FGF23 PicoKine ELISA Kit
MBS1751556-02 5x 96 Well

Rat FGF23 PicoKine ELISA Kit

Sign In for Pricing
View Details
Rno-miR-3589 miRNA Antagomir
CIS0655-01 10 nmol

Rno-miR-3589 miRNA Antagomir

Sign In for Pricing
View Details
Rno-miR-3589 miRNA Antagomir
CIS0655-02 20 nmol

Rno-miR-3589 miRNA Antagomir

Sign In for Pricing
View Details
Mouse Neuronal PAS domain-containing protein 2 (NPAS2) ELISA Kit
abx535634 96 Tests

Mouse Neuronal PAS domain-containing protein 2 (NPAS2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Tomato bushy stunt virus Movement protein p22 (ORF3)
MBS1173480-01 0.02 mg (E-Coli)

Recombinant Tomato bushy stunt virus Movement protein p22 (ORF3)

Sign In for Pricing
View Details