Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6AP2, Human (His-SUMO)

The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His-SUMO) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

ATP6AP2 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp6ap2-protein-human-his-sumo.html

Purity

90.0

Smiles

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Molecular Formula

10159 (Gene_ID) O75787 (N17-D350) (Accession)

Molecular Weight

Approximately 53.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carbinoxamine N-Oxide-d6
TRC-C176007-25MG 25 mg

Carbinoxamine N-Oxide-d6

Sign In for Pricing
View Details
FAM151B Antibody, FITC conjugated
A58154-100UG 100 µg

FAM151B Antibody, FITC conjugated

Sign In for Pricing
View Details
Recombinant Vibrio Cholerae hemF Protein (aa 1-305)
VAng-Cr3274-500gEcoli 500 µg (E. coli)

Recombinant Vibrio Cholerae hemF Protein (aa 1-305)

Sign In for Pricing
View Details
Recombinant Mouse Carbonic Anhydrase IV / Car4 Protein (His tag)
E53A06664 50 µg

Recombinant Mouse Carbonic Anhydrase IV / Car4 Protein (His tag)

Sign In for Pricing
View Details
FITC Conjugated, Anti-CD11a / LFA-1 alpha chain Monoclonal Antibody (Clone:M17/4)
30-2055-0.1 0.1 mg

FITC Conjugated, Anti-CD11a / LFA-1 alpha chain Monoclonal Antibody (Clone:M17/4)

Sign In for Pricing
View Details
Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) ttc30a Polyclonal Antibody
MBS7142519 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) ttc30a Polyclonal Antibody

Sign In for Pricing
View Details