Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6AP2, Human (His-SUMO)

The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His-SUMO) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

ATP6AP2 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp6ap2-protein-human-his-sumo.html

Purity

90.0

Smiles

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Molecular Formula

10159 (Gene_ID) O75787 (N17-D350) (Accession)

Molecular Weight

Approximately 53.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-Off-mmu-miR-3154 Vector
mm31103 500 ng

LentimiRa-Off-mmu-miR-3154 Vector

Sign In for Pricing
View Details
Psors1c2 sgRNA CRISPR Lentivector set (Mouse)
K3458201 3x 1.0 µg

Psors1c2 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Ace Antibody
A78598-50UL 50 μL

Ace Antibody

Sign In for Pricing
View Details
SLC38A4 Protein Vector (Human) (pPM-C-His)
PV038784 500 ng

SLC38A4 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Chicken Leptin, LEP ELISA Kit
CK-bio-18185-01 48 Tests

Chicken Leptin, LEP ELISA Kit

Sign In for Pricing
View Details
Chicken Leptin, LEP ELISA Kit
CK-bio-18185-02 96 Tests

Chicken Leptin, LEP ELISA Kit

Sign In for Pricing
View Details