Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6AP2, Human (His-SUMO)

The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His-SUMO) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

ATP6AP2 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp6ap2-protein-human-his-sumo.html

Purity

90.0

Smiles

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Molecular Formula

10159 (Gene_ID) O75787 (N17-D350) (Accession)

Molecular Weight

Approximately 53.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MEF2D Recombinant Protein (N-His)
HC715012-01 50 µg

Human MEF2D Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human MEF2D Recombinant Protein (N-His)
HC715012-02 100 µg

Human MEF2D Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human MEF2D Recombinant Protein (N-His)
HC715012-03 1 mg

Human MEF2D Recombinant Protein (N-His)

Sign In for Pricing
View Details
Ovol2 (NM_026924) Mouse Tagged ORF Clone Lentiviral Particle
MR203678L3V 200 µL

Ovol2 (NM_026924) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Vopratelimab Biosimilar (Monoclonal, IgG1-kappa)
A135052 100 µL

Vopratelimab Biosimilar (Monoclonal, IgG1-kappa)

Sign In for Pricing
View Details
Buflomedil Hydrochloride EP Impurity C
RM-B210603-01 10 mg

Buflomedil Hydrochloride EP Impurity C

Sign In for Pricing
View Details