Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6AP2, Human (His-SUMO)

The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His-SUMO) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

ATP6AP2 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp6ap2-protein-human-his-sumo.html

Purity

90.0

Smiles

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Molecular Formula

10159 (Gene_ID) O75787 (N17-D350) (Accession)

Molecular Weight

Approximately 53.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RP23 Protein Vector (Human) (pPM-C-His)
PV119689 500 ng

RP23 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Bcl6 3'UTR GFP Stable Cell Line
TU152692 1.0 mL

Bcl6 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
ERK5 (MAPK7) Human shRNA Plasmid Kit (Locus ID 5598)
TR318699 1 Kit

ERK5 (MAPK7) Human shRNA Plasmid Kit (Locus ID 5598)

Sign In for Pricing
View Details
Anti-RAC3 Antibody (R1Z77)
RHF37602 100 μg

Anti-RAC3 Antibody (R1Z77)

Sign In for Pricing
View Details
Canine Claudin 4 ELISA Kit
MBS065596-01 48 Well

Canine Claudin 4 ELISA Kit

Sign In for Pricing
View Details
Canine Claudin 4 ELISA Kit
MBS065596-02 96 Well

Canine Claudin 4 ELISA Kit

Sign In for Pricing
View Details