Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6AP2, Human (His-SUMO)

The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His-SUMO) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

ATP6AP2 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp6ap2-protein-human-his-sumo.html

Purity

90.0

Smiles

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Molecular Formula

10159 (Gene_ID) O75787 (N17-D350) (Accession)

Molecular Weight

Approximately 53.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIST1H2BM Protein Vector (Mouse) (pPB-N-His)
PV188835 500 ng

HIST1H2BM Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
PE anti-Human ANTXR2
B2015453 10 µg

PE anti-Human ANTXR2

Sign In for Pricing
View Details
MKRN6P Protein Vector (Human) (pPM-C-His)
PV100433 500 ng

MKRN6P Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
GSTM2 (NM_000848) Human Recombinant Protein
TP310718M 100 µg

GSTM2 (NM_000848) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Mouse Myosin Light Chain Kinase (MYLK)
RPU42902-01 50 µg

Recombinant Mouse Myosin Light Chain Kinase (MYLK)

Sign In for Pricing
View Details
Recombinant Mouse Myosin Light Chain Kinase (MYLK)
RPU42902-02 100 µg

Recombinant Mouse Myosin Light Chain Kinase (MYLK)

Sign In for Pricing
View Details