Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6AP2, Human (His-SUMO)

The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His-SUMO) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

ATP6AP2 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp6ap2-protein-human-his-sumo.html

Purity

90.0

Smiles

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Molecular Formula

10159 (Gene_ID) O75787 (N17-D350) (Accession)

Molecular Weight

Approximately 53.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CACNB1 Antibody
MBS9401320-01 0.1 mL

CACNB1 Antibody

Sign In for Pricing
View Details
CACNB1 Antibody
MBS9401320-02 5x 0.1 mL

CACNB1 Antibody

Sign In for Pricing
View Details
FAM222B Antibody, Biotin conjugated
A65195-50UG 50 µg

FAM222B Antibody, Biotin conjugated

Sign In for Pricing
View Details
ACOX1 Polyclonal Antibody
ANT-10046-100ug 100 µg

ACOX1 Polyclonal Antibody

Sign In for Pricing
View Details
MICA (MHC Class I Polypeptide-related Sequence A, MIC-A, PERB11.1) (MaxLight 650)
138130-ML650 100 µL

MICA (MHC Class I Polypeptide-related Sequence A, MIC-A, PERB11.1) (MaxLight 650)

Sign In for Pricing
View Details
Mouse IL-13 ELISA Kit
CEK1494 96 Tests

Mouse IL-13 ELISA Kit

Sign In for Pricing
View Details