Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6AP2, Human (His-SUMO)

The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His-SUMO) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

ATP6AP2 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp6ap2-protein-human-his-sumo.html

Purity

90.0

Smiles

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Molecular Formula

10159 (Gene_ID) O75787 (N17-D350) (Accession)

Molecular Weight

Approximately 53.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ttll4 Mouse shRNA Plasmid (Locus ID 67534)
TR503929 1 Kit

Ttll4 Mouse shRNA Plasmid (Locus ID 67534)

Sign In for Pricing
View Details
TRNAK41P AAV siRNA Pooled Vector
48139161 1.0 µg

TRNAK41P AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Mouse protein kinase B,PKB ELISA Kit
CN-02712M2 48T

Mouse protein kinase B,PKB ELISA Kit

Sign In for Pricing
View Details
CRFR2 Antibody
AF5306-01 100 µL

CRFR2 Antibody

Sign In for Pricing
View Details
CRFR2 Antibody
AF5306-02 200 µL

CRFR2 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Pnma1 shRNA (UAS) - Lentiviral mouse Pnma1 shRNA (UAS, RFP) plasmid
GTR15292993 1 Vial

Lentiviral mouse Pnma1 shRNA (UAS) - Lentiviral mouse Pnma1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details