Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6AP2, Human (His-SUMO)

The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His-SUMO) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

ATP6AP2 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp6ap2-protein-human-his-sumo.html

Purity

90.0

Smiles

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Molecular Formula

10159 (Gene_ID) O75787 (N17-D350) (Accession)

Molecular Weight

Approximately 53.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ECHDC2 Protein Vector (Rat) (pPM-C-HA)
PV265360 500 ng

ECHDC2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Microscope Slide Boxes,25-Place, Green
LC7008-010 10 / Pack

Microscope Slide Boxes,25-Place, Green

Sign In for Pricing
View Details
Wwp1 3'UTR Luciferase Stable Cell Line
TU223452 1.0 mL

Wwp1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rat LCAT (Lecithin Cholesterol Acyltransferase) ELISA Kit
EK245568 96 Well

Rat LCAT (Lecithin Cholesterol Acyltransferase) ELISA Kit

Sign In for Pricing
View Details
NAALAD2 (NM_005467) Human Recombinant Protein
PH34886M5 20 µg

NAALAD2 (NM_005467) Human Recombinant Protein

Sign In for Pricing
View Details
CYFP1 Polyclonal Antibody
ABP58313-01 30 µL

CYFP1 Polyclonal Antibody

Sign In for Pricing
View Details