Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6AP2, Human (His-SUMO)

The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His-SUMO) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

ATP6AP2 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp6ap2-protein-human-his-sumo.html

Purity

90.0

Smiles

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Molecular Formula

10159 (Gene_ID) O75787 (N17-D350) (Accession)

Molecular Weight

Approximately 53.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,3'- (Propane-1,3-diyl) bis (1- (prop-1-en-2-yl) -1H-benzo[d]imidazol-2 (3H) -one) -d6
sc-476159 2.5 mg

3,3'- (Propane-1,3-diyl) bis (1- (prop-1-en-2-yl) -1H-benzo[d]imidazol-2 (3H) -one) -d6

Sign In for Pricing
View Details
CDK8-IN-1 10mg
A12961-10 10 mg

CDK8-IN-1 10mg

Sign In for Pricing
View Details
Recombinant Human SHMT2 Protein, N-His
HW418012-01 50 µg

Recombinant Human SHMT2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human SHMT2 Protein, N-His
HW418012-02 100 µg

Recombinant Human SHMT2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human SHMT2 Protein, N-His
HW418012-03 1 mg

Recombinant Human SHMT2 Protein, N-His

Sign In for Pricing
View Details
4-Nitrophenyl 2,4,6-tri-O-acetyl-3-O (2,3,4,6-tetra-O-acetyl-b-D-glucopyranosyl) -a-D-glucopyranoside
257963-01 500 µg

4-Nitrophenyl 2,4,6-tri-O-acetyl-3-O (2,3,4,6-tetra-O-acetyl-b-D-glucopyranosyl) -a-D-glucopyranoside

Sign In for Pricing
View Details