Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6AP2, Human (His-SUMO)

The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His-SUMO) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

ATP6AP2 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp6ap2-protein-human-his-sumo.html

Purity

90.0

Smiles

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Molecular Formula

10159 (Gene_ID) O75787 (N17-D350) (Accession)

Molecular Weight

Approximately 53.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EML1 Rabbit pAb
A17479 200 µL

EML1 Rabbit pAb

Sign In for Pricing
View Details
MMP19 Rabbit Polyclonal Antibody
TA330243 100 µL

MMP19 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal CRISPR-Cas9 Antibody (7A9-3A3) [DyLight 350]
NBP2-36440UV 0.1 mL

Mouse Monoclonal CRISPR-Cas9 Antibody (7A9-3A3) [DyLight 350]

Sign In for Pricing
View Details
GZMK (granzyme K (granzyme 3; tryptase II), TRYP2)
246889 50 µL

GZMK (granzyme K (granzyme 3; tryptase II), TRYP2)

Sign In for Pricing
View Details
TRIOBP siRNA Oligos set (Human)
47854171 3x 5 nmol

TRIOBP siRNA Oligos set (Human)

Sign In for Pricing
View Details
Porcine MKI67 FHA domain-interacting nucleolar phosphoprotein (MKI67IP) ELISA Kit
MBS2607867-01 48 Well

Porcine MKI67 FHA domain-interacting nucleolar phosphoprotein (MKI67IP) ELISA Kit

Sign In for Pricing
View Details