Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6AP2, Human (His-SUMO)

The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His-SUMO) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

ATP6AP2 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp6ap2-protein-human-his-sumo.html

Purity

90.0

Smiles

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Molecular Formula

10159 (Gene_ID) O75787 (N17-D350) (Accession)

Molecular Weight

Approximately 53.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAGE (Receptor for Advanced Glycosylation End Products, Advanced Glycosylation End Product-specific Receptor, AGER) (AP)
MBS6241908-01 0.1 mL

RAGE (Receptor for Advanced Glycosylation End Products, Advanced Glycosylation End Product-specific Receptor, AGER) (AP)

Sign In for Pricing
View Details
RAGE (Receptor for Advanced Glycosylation End Products, Advanced Glycosylation End Product-specific Receptor, AGER) (AP)
MBS6241908-02 5x 0.1 mL

RAGE (Receptor for Advanced Glycosylation End Products, Advanced Glycosylation End Product-specific Receptor, AGER) (AP)

Sign In for Pricing
View Details
Goat Polyclonal c-Myc Antibody [Agarose]
NB600-342 0.1 mg

Goat Polyclonal c-Myc Antibody [Agarose]

Sign In for Pricing
View Details
Recombinant Legionella Pneumophila ruvC Protein (aa 1-174) (strain Paris)
VAng-Lsx04220-1mgEcoli 1 mg (E. coli)

Recombinant Legionella Pneumophila ruvC Protein (aa 1-174) (strain Paris)

Sign In for Pricing
View Details
ZIC1 (NM_003412) Human Tagged ORF Clone Lentiviral Particle
RC211177L3V 200 µL

ZIC1 (NM_003412) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human Putative uncharacterized protein C1orf140 (C1orf140) ELISA Kit
abx504420 96 Tests

Human Putative uncharacterized protein C1orf140 (C1orf140) ELISA Kit

Sign In for Pricing
View Details