Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6AP2, Human (His-SUMO)

The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His-SUMO) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

ATP6AP2 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp6ap2-protein-human-his-sumo.html

Purity

90.0

Smiles

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Molecular Formula

10159 (Gene_ID) O75787 (N17-D350) (Accession)

Molecular Weight

Approximately 53.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TLK1 (N-GST tag)
Z500388 10 µg

Recombinant Human TLK1 (N-GST tag)

Sign In for Pricing
View Details
Ncoa5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4555305 3x 1.0 µg

Ncoa5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
WIZ Protein Lysate (Human) with C-Ha Tag
50437031 100 µg

WIZ Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
NQO2 Recombinant Antibody, Cy5 Conjugated
bsm-61281R-Cy5-01 20 µL

NQO2 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
NQO2 Recombinant Antibody, Cy5 Conjugated
bsm-61281R-Cy5-02 100 µL

NQO2 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
GAPDH protein (Rabbit)
MBS537510-01 0.3 mg

GAPDH protein (Rabbit)

Sign In for Pricing
View Details