Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6AP2, Human (His-SUMO)

The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His-SUMO) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

ATP6AP2 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp6ap2-protein-human-his-sumo.html

Purity

90.0

Smiles

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Molecular Formula

10159 (Gene_ID) O75787 (N17-D350) (Accession)

Molecular Weight

Approximately 53.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Monoclonal CD11c Antibody (N418) [PE/Cy7]
FAB69501PECY7 0.1 mL

Hamster Monoclonal CD11c Antibody (N418) [PE/Cy7]

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS524066 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
SAG Antibody, HRP conjugated
A34120-50UG 50 µg

SAG Antibody, HRP conjugated

Sign In for Pricing
View Details
CXCL6 (Chemokine (C-X-C Motif) Ligand 6 (Granulocyte chemotactic Protein 2), CKA-3, GCP-2, GCP2, SCYB6) (MaxLight 490)
245114-ML490 100 µL

CXCL6 (Chemokine (C-X-C Motif) Ligand 6 (Granulocyte chemotactic Protein 2), CKA-3, GCP-2, GCP2, SCYB6) (MaxLight 490)

Sign In for Pricing
View Details
Lentiviral mouse Zfp799 shRNA (UAS) - Lentiviral mouse Zfp799 shRNA (UAS) (25)
GTR15223085 1 Vial

Lentiviral mouse Zfp799 shRNA (UAS) - Lentiviral mouse Zfp799 shRNA (UAS) (25)

Sign In for Pricing
View Details
Map4k4 (NM_008696) Mouse Untagged Clone
MC224012 10 µg

Map4k4 (NM_008696) Mouse Untagged Clone

Sign In for Pricing
View Details