Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6AP2, Human (His-SUMO)

The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His-SUMO) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

ATP6AP2 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp6ap2-protein-human-his-sumo.html

Purity

90.0

Smiles

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Molecular Formula

10159 (Gene_ID) O75787 (N17-D350) (Accession)

Molecular Weight

Approximately 53.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBX6, ID (TBX6, T-box transcription factor TBX6) (MaxLight 405) discontinued
042672-ML405 100 µL

TBX6, ID (TBX6, T-box transcription factor TBX6) (MaxLight 405) discontinued

Sign In for Pricing
View Details
TM168, CT (TMEM168, Transmembrane protein 168) (MaxLight 750) discontinued
042891-ML750 100 µL

TM168, CT (TMEM168, Transmembrane protein 168) (MaxLight 750) discontinued

Sign In for Pricing
View Details
C-reactive Protein (CRP) Test Kit-human whole blood, serum or plasma
D-CICRPK40 40 Tests

C-reactive Protein (CRP) Test Kit-human whole blood, serum or plasma

Sign In for Pricing
View Details
1,6-Anhydro-β-D-cellotriose nonaacetate
GC2336-5mg 5 mg

1,6-Anhydro-β-D-cellotriose nonaacetate

Sign In for Pricing
View Details
emopamil binding protein (EBP) Human shRNA Plasmid Kit (Locus ID 10682)
TL313312 1 Kit

emopamil binding protein (EBP) Human shRNA Plasmid Kit (Locus ID 10682)

Sign In for Pricing
View Details
LRMP Polyclonal Antibody
MBS9432133-01 0.05 mL

LRMP Polyclonal Antibody

Sign In for Pricing
View Details