Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6AP2, Human (His-SUMO)

The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His-SUMO) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

ATP6AP2 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp6ap2-protein-human-his-sumo.html

Purity

90.0

Smiles

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Molecular Formula

10159 (Gene_ID) O75787 (N17-D350) (Accession)

Molecular Weight

Approximately 53.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diquat-d4 Dibromide
TRC-D492902-50MG 50 mg

Diquat-d4 Dibromide

Sign In for Pricing
View Details
anti-Fyn
YF-PA23746 50 ul

anti-Fyn

Sign In for Pricing
View Details
Rln3 (Relaxin-3) BioAssayTM ELISA Kit (Mouse) discontinued
358572-01 48 Tests

Rln3 (Relaxin-3) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
Rln3 (Relaxin-3) BioAssayTM ELISA Kit (Mouse) discontinued
358572-02 96 Tests

Rln3 (Relaxin-3) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
H2AFY (MACROH2A1) (NM_138609) Human Tagged Lenti ORF Clone
RC211469L3 10 µg

H2AFY (MACROH2A1) (NM_138609) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TRNAG21 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV752038 1.0 µg DNA

TRNAG21 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details