Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6AP2, Human (His-SUMO)

The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His-SUMO) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

ATP6AP2 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atp6ap2-protein-human-his-sumo.html

Purity

90.0

Smiles

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Molecular Formula

10159 (Gene_ID) O75787 (N17-D350) (Accession)

Molecular Weight

Approximately 53.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF640R conjugate, 0.1mg/mL
BNC400164-500 1x 500 µL

CD28 (204.12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF680R conjugate, 0.1mg/mL
BNC810152-100 1x 100 µL

CD11c (HC1/1), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL
BNC040460-500 1x 500 µL

CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL
BNC400676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF640R conjugate, 0.1mg/mL
BNC400305-100 1x 100 µL

CD95 (B-R18), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL
BNC551050-500 1x 500 µL

CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details