Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIAE, Human (HEK293, His)

SIAE proteins play a key role in cellular processes by catalyzing the removal of the O-acetyl ester group specifically from the 9-position of the parent sialic acid N-acetylneuraminic acid. Through this enzymatic activity, SIAE helps regulate sialic acid modifications, affecting various biological functions associated with cell surface glycoconjugates. SIAE Protein, Human (HEK293, His) is the recombinant human-derived SIAE protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SIAE Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/siae-protein-human-hek-293-his.html

Purity

98.0

Smiles

IGFRFASYINNDMVLQKEPAGAVIWGFGTPGATVTVTLRQGQETIMKKVTSVKAHSDTWMVVLDPMKPGGPFEVMAQQTLEKINFTLRVHDVLFGDVWLCSGQSNMQMTVLQIFNATRELSNTAAYQSVRILSVSPIQAEQELEDLVAVDLQWSKPTSENLGHGYFKYMSAVCWLFGRHLYDTLQYPIGLIASSWGGTPIEAWSSGRSLKACGVPKQGSIPYDSVTGPSKHSVLWNAMIHPLCNMTLKGVVWYQGESNINYNTDLYNCTFPALIEDWRETFHRGSQGQTERFFPFGLVQLSSDLSKKSSDDGFPQIRWHQTADFGYVPNPKMPNTFMAVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEKNLTFEGPLPEKIELLAHKGLLNLTYYQQIQVQKKDNKIFEISCCSDHRCKWLPASMNTVSTQSLTLAIDSCHGTVVALRYAWTTWPCEYKQCPLYHPSSALPAPPFIAFITDQGPGHQSNVAK

Molecular Formula

54414 (Gene_ID) Q9HAT2-1 (I24-K523) (Accession)

Molecular Weight

64-77 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF665 Human siRNA Oligo Duplex (Locus ID 79788)
SR312599 1 Kit

ZNF665 Human siRNA Oligo Duplex (Locus ID 79788)

Sign In for Pricing
View Details
Myo-Inositol
GC4902-100g 100 g

Myo-Inositol

Sign In for Pricing
View Details
HECTD3 Protein Vector (Human) (pPM-C-His)
PV052988 500 ng

HECTD3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
ASMEPM-37X230MM-GLYCOL Pipe Markers for Acids & Bases
312859 3 Card (3 Marker (s) x 1 Pack)

ASMEPM-37X230MM-GLYCOL Pipe Markers for Acids & Bases

Sign In for Pricing
View Details
CENPJ (NM_018451) Human Over-expression Lysate
LS055835 100 µg

CENPJ (NM_018451) Human Over-expression Lysate

Sign In for Pricing
View Details
IGFBP7 Human shRNA Plasmid Kit (Locus ID 3490)
TR312216 1 Kit

IGFBP7 Human shRNA Plasmid Kit (Locus ID 3490)

Sign In for Pricing
View Details