Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC4D, Rat (HEK293, His)

CLEC4D, a calcium-dependent lectin, detects DAMPs and PAMPs from bacteria and fungi. It interacts with FCER1G in myeloid cells, forming a functional complex that activates signaling pathways and promotes antigen-presenting cell maturation and T-cell priming. CLEC4D also combats fungal infections and contributes to antigen uptake for clearance or presentation to T-cells. Its interaction with CLEC4E strengthens the interaction with FCER1G. CLEC4D Protein, Rat (HEK293, His) is the recombinant rat-derived CLEC4D protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CLEC4D Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clec4d-protein-rat-hek293-his.html

Purity

96.00

Smiles

WKRGSALKFSDYHTRLTCILEEPQPGATGGTWTCCPVSWRAFQSNCYFALNDNQTWHESERNCSGMSSHLVTINTEAEQDFVTQLLDEQFSYFLGLSYEKVEGQWQWVDKTPFNPNVVFWKVGEPKDSMEEDCVVLVYDQDKWVWNDFPCHFEMGRICKLPGATFDWNPSK

Molecular Formula

362432 (Gene_ID) Q69FH1 (W48-K218) (Accession)

Molecular Weight

Approximately 23-30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Tnfrsf8 (NM_019135) Rat Tagged ORF Clone Lentiviral Particle
RR200681L3V 200 µL

Tnfrsf8 (NM_019135) Rat Tagged ORF Clone Lentiviral Particle

Ask
View Details
AdmiRa-hsa-miR-300-Off Virus
mh5404 1.0 mL

AdmiRa-hsa-miR-300-Off Virus

Ask
View Details
Rabbit Polyclonal ZNF622 Antibody [DyLight 488]
NBP2-32087G 0.1 mL

Rabbit Polyclonal ZNF622 Antibody [DyLight 488]

Ask
View Details
PTPRN2 (Protein Tyrosine Phosphatase, Receptor Type, N Polypeptide 2, IA-2beta, IAR, ICAAR, PTPRP) (FITC)
MBS6177374-01 0.1 mL

PTPRN2 (Protein Tyrosine Phosphatase, Receptor Type, N Polypeptide 2, IA-2beta, IAR, ICAAR, PTPRP) (FITC)

Ask
View Details
PTPRN2 (Protein Tyrosine Phosphatase, Receptor Type, N Polypeptide 2, IA-2beta, IAR, ICAAR, PTPRP) (FITC)
MBS6177374-02 5x 0.1 mL

PTPRN2 (Protein Tyrosine Phosphatase, Receptor Type, N Polypeptide 2, IA-2beta, IAR, ICAAR, PTPRP) (FITC)

Ask
View Details
OXSM (15G8) Mouse Monoclonal antibody
E28PE4016 100 µL

OXSM (15G8) Mouse Monoclonal antibody

Ask
View Details