Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC4D, Rat (HEK293, His)

CLEC4D, a calcium-dependent lectin, detects DAMPs and PAMPs from bacteria and fungi. It interacts with FCER1G in myeloid cells, forming a functional complex that activates signaling pathways and promotes antigen-presenting cell maturation and T-cell priming. CLEC4D also combats fungal infections and contributes to antigen uptake for clearance or presentation to T-cells. Its interaction with CLEC4E strengthens the interaction with FCER1G. CLEC4D Protein, Rat (HEK293, His) is the recombinant rat-derived CLEC4D protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CLEC4D Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clec4d-protein-rat-hek293-his.html

Purity

96.00

Smiles

WKRGSALKFSDYHTRLTCILEEPQPGATGGTWTCCPVSWRAFQSNCYFALNDNQTWHESERNCSGMSSHLVTINTEAEQDFVTQLLDEQFSYFLGLSYEKVEGQWQWVDKTPFNPNVVFWKVGEPKDSMEEDCVVLVYDQDKWVWNDFPCHFEMGRICKLPGATFDWNPSK

Molecular Formula

362432 (Gene_ID) Q69FH1 (W48-K218) (Accession)

Molecular Weight

Approximately 23-30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Transmembrane channel-like protein 1 (TMC1) ELISA Kit
abx550357 96 Tests

Mouse Transmembrane channel-like protein 1 (TMC1) ELISA Kit

Ask
View Details
Rat Prostaglandin reductase 1, PTGR1 ELISA KIT
E0945Ra-01 48 Well

Rat Prostaglandin reductase 1, PTGR1 ELISA KIT

Ask
View Details
Rat Prostaglandin reductase 1, PTGR1 ELISA KIT
E0945Ra-02 96 Well

Rat Prostaglandin reductase 1, PTGR1 ELISA KIT

Ask
View Details
Rat Prostaglandin reductase 1, PTGR1 ELISA KIT
E0945Ra-03 5x 96 Tests

Rat Prostaglandin reductase 1, PTGR1 ELISA KIT

Ask
View Details
Rat Prostaglandin reductase 1, PTGR1 ELISA KIT
E0945Ra-04 10x 96 Tests

Rat Prostaglandin reductase 1, PTGR1 ELISA KIT

Ask
View Details
Mouse DDB1- and CUL4-associated factor 6, Dcaf6 ELISA KIT
ELI-09048m 96 Tests

Mouse DDB1- and CUL4-associated factor 6, Dcaf6 ELISA KIT

Ask
View Details