Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC4D, Rat (HEK293, His)

CLEC4D, a calcium-dependent lectin, detects DAMPs and PAMPs from bacteria and fungi. It interacts with FCER1G in myeloid cells, forming a functional complex that activates signaling pathways and promotes antigen-presenting cell maturation and T-cell priming. CLEC4D also combats fungal infections and contributes to antigen uptake for clearance or presentation to T-cells. Its interaction with CLEC4E strengthens the interaction with FCER1G. CLEC4D Protein, Rat (HEK293, His) is the recombinant rat-derived CLEC4D protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CLEC4D Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clec4d-protein-rat-hek293-his.html

Purity

96.00

Smiles

WKRGSALKFSDYHTRLTCILEEPQPGATGGTWTCCPVSWRAFQSNCYFALNDNQTWHESERNCSGMSSHLVTINTEAEQDFVTQLLDEQFSYFLGLSYEKVEGQWQWVDKTPFNPNVVFWKVGEPKDSMEEDCVVLVYDQDKWVWNDFPCHFEMGRICKLPGATFDWNPSK

Molecular Formula

362432 (Gene_ID) Q69FH1 (W48-K218) (Accession)

Molecular Weight

Approximately 23-30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-Neuroligin-1 Antibody (N97A/32)
RHN12602 100 μg

Anti-Neuroligin-1 Antibody (N97A/32)

Ask
View Details
Rabbit Polyclonal Cyclin D3 Antibody
NBP2-98877-100ul 100 µL

Rabbit Polyclonal Cyclin D3 Antibody

Ask
View Details
Tumor protein D52 like 3 (TPD52L3) Mouse Monoclonal Antibody [Clone ID: OTI6E1]
TA504952S 30 µL

Tumor protein D52 like 3 (TPD52L3) Mouse Monoclonal Antibody [Clone ID: OTI6E1]

Ask
View Details
Recombinant Enterobacteria phage K1F Endo-N-acetylneuraminidase, partial
MBS1226770-01 0.02 mg (E-Coli)

Recombinant Enterobacteria phage K1F Endo-N-acetylneuraminidase, partial

Ask
View Details
Recombinant Enterobacteria phage K1F Endo-N-acetylneuraminidase, partial
MBS1226770-02 0.02 mg (Yeast)

Recombinant Enterobacteria phage K1F Endo-N-acetylneuraminidase, partial

Ask
View Details
Recombinant Enterobacteria phage K1F Endo-N-acetylneuraminidase, partial
MBS1226770-03 0.1 mg (E-Coli)

Recombinant Enterobacteria phage K1F Endo-N-acetylneuraminidase, partial

Ask
View Details