Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC4D, Rat (HEK293, His)

CLEC4D, a calcium-dependent lectin, detects DAMPs and PAMPs from bacteria and fungi. It interacts with FCER1G in myeloid cells, forming a functional complex that activates signaling pathways and promotes antigen-presenting cell maturation and T-cell priming. CLEC4D also combats fungal infections and contributes to antigen uptake for clearance or presentation to T-cells. Its interaction with CLEC4E strengthens the interaction with FCER1G. CLEC4D Protein, Rat (HEK293, His) is the recombinant rat-derived CLEC4D protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CLEC4D Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clec4d-protein-rat-hek293-his.html

Purity

96.00

Smiles

WKRGSALKFSDYHTRLTCILEEPQPGATGGTWTCCPVSWRAFQSNCYFALNDNQTWHESERNCSGMSSHLVTINTEAEQDFVTQLLDEQFSYFLGLSYEKVEGQWQWVDKTPFNPNVVFWKVGEPKDSMEEDCVVLVYDQDKWVWNDFPCHFEMGRICKLPGATFDWNPSK

Molecular Formula

362432 (Gene_ID) Q69FH1 (W48-K218) (Accession)

Molecular Weight

Approximately 23-30 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral mouse Ins2 shRNA (UAS) - Lentiviral mouse Ins2 shRNA (UAS, RFP) plasmid
GTR15252433 1 Vial

Lentiviral mouse Ins2 shRNA (UAS) - Lentiviral mouse Ins2 shRNA (UAS, RFP) plasmid

Ask
View Details
PSMF1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
38022126 3x 1.0µg DNA

PSMF1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Ask
View Details
Prkcq sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
37645114 3x 1.0 µg

Prkcq sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Ask
View Details
Mouse Monoclonal PIK3C2A Antibody (OTI3H2) [DyLight 405]
NBP2-73405V 0.1 mL

Mouse Monoclonal PIK3C2A Antibody (OTI3H2) [DyLight 405]

Ask
View Details