Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A16 , Human

S100A16 is a calcium-binding protein that binds one calcium ion per monomer. It is associated with the promotion of adipocyte differentiation in vitro, suggesting a potential regulatory role in cell development. S100A16 Protein, Human is the recombinant human-derived S100A16 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

S100A16 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a16-protein-human.html

Purity

95.0

Smiles

MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS

Molecular Formula

140576 (Gene_ID) Q96FQ6 (M1-S103) (Accession)

Molecular Weight

Approximately 12.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Abcd3 (NM_008991) Mouse Tagged Lenti ORF Clone
MR222851L4 10 µg

Abcd3 (NM_008991) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GSK2110183 analog 1 (hydrochloride)
HY-15966A-01 5 mg

GSK2110183 analog 1 (hydrochloride)

Sign In for Pricing
View Details
GSK2110183 analog 1 (hydrochloride)
HY-15966A-02 10 mM - 1 mL

GSK2110183 analog 1 (hydrochloride)

Sign In for Pricing
View Details
GSK2110183 analog 1 (hydrochloride)
HY-15966A-03 10 mg

GSK2110183 analog 1 (hydrochloride)

Sign In for Pricing
View Details
GSK2110183 analog 1 (hydrochloride)
HY-15966A-04 50 mg

GSK2110183 analog 1 (hydrochloride)

Sign In for Pricing
View Details
GSK2110183 analog 1 (hydrochloride)
HY-15966A-05 100 mg

GSK2110183 analog 1 (hydrochloride)

Sign In for Pricing
View Details