S100A16 , Human
S100A16 is a calcium-binding protein that binds one calcium ion per monomer. It is associated with the promotion of adipocyte differentiation in vitro, suggesting a potential regulatory role in cell development. S100A16 Protein, Human is the recombinant human-derived S100A16 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
S100A16 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/s100a16-protein-human.html
Purity
95.0
Smiles
MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS
Molecular Formula
140576 (Gene_ID) Q96FQ6 (M1-S103) (Accession)
Molecular Weight
Approximately 12.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
![Rabbit Polyclonal NAA10 Antibody [Biotin]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
CLEC2B, ID (CLEC2B, AICL, CLECSF2, IFNRG1, C-type lectin domain family 2 member B, Activation-induced C-type lectin, C-type lectin superfamily member 2, IFN-alpha-2b-inducing-related protein 1) (MaxLight 405)
CLEC2B, ID (CLEC2B, AICL, CLECSF2, IFNRG1, C-type lectin domain family 2 member B, Activation-induced C-type lectin, C-type lectin superfamily member 2, IFN-alpha-2b-inducing-related protein 1) (MaxLight 405)