Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A16 , Human

S100A16 is a calcium-binding protein that binds one calcium ion per monomer. It is associated with the promotion of adipocyte differentiation in vitro, suggesting a potential regulatory role in cell development. S100A16 Protein, Human is the recombinant human-derived S100A16 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

S100A16 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a16-protein-human.html

Purity

95.0

Smiles

MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS

Molecular Formula

140576 (Gene_ID) Q96FQ6 (M1-S103) (Accession)

Molecular Weight

Approximately 12.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

[3- (Thiophen-2-yl) -1,2,4-oxadiazol-5-yl]methanamine
IMB69902-01 0.5 g

[3- (Thiophen-2-yl) -1,2,4-oxadiazol-5-yl]methanamine

Sign In for Pricing
View Details
[3- (Thiophen-2-yl) -1,2,4-oxadiazol-5-yl]methanamine
IMB69902-02 5 g

[3- (Thiophen-2-yl) -1,2,4-oxadiazol-5-yl]methanamine

Sign In for Pricing
View Details
Hsa-miR-144-5p miRNA Agomir
orb1921014-01 5 nmol

Hsa-miR-144-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-144-5p miRNA Agomir
orb1921014-02 10 nmol

Hsa-miR-144-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-144-5p miRNA Agomir
orb1921014-03 20 nmol

Hsa-miR-144-5p miRNA Agomir

Sign In for Pricing
View Details
Phospho-Histone H4-S1 pAb
E9P0901 100 µL

Phospho-Histone H4-S1 pAb

Sign In for Pricing
View Details