Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human coronavirus HKU1 Non-structural protein 4 (4)

Product Specifications

Product Name Alternative

Accessory protein 4 Non-structural protein of 12.5 kDa Orf4 protein

Abbreviation

Recombinant Human coronavirus HKU1 Non-structural protein 4

Gene Name

4

UniProt

Q5MQC9

Expression Region

1-109aa

Organism

Human coronavirus HKU1 (isolate N1) (HCoV-HKU1)

Target Sequence

MDVWRPSYTHSLVIREFGVTNLEDLCLKYNYCQPIVGYCIVPLNVWCRKFGKFASHFTLRSHDISHSNNFGVVTSFTTYGNTVSEAVSRLVESASEFIVWRAEALNKYG

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein & Coronavirus Protein

Source

Baculovirus

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

13.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MFAP3 Protein, His, E.coli-5ug
QP12690-5ug 5ug

Recombinant Human MFAP3 Protein, His, E.coli-5ug

Sign In for Pricing
View Details
RG-12525 25mg
A19926-25 25 mg

RG-12525 25mg

Sign In for Pricing
View Details
FAM133A (NM_173698) Human Over-expression Lysate
LY406566 100 µg

FAM133A (NM_173698) Human Over-expression Lysate

Sign In for Pricing
View Details
OSGIN1, CT (OSGIN1, OKL38, Oxidative stress-induced growth inhibitor 1, Ovary, kidney and liver protein 38, Pregnancy-induced growth inhibitor OKL38) (Azide free) (HRP)
MBS6329739-01 0.2 mL

OSGIN1, CT (OSGIN1, OKL38, Oxidative stress-induced growth inhibitor 1, Ovary, kidney and liver protein 38, Pregnancy-induced growth inhibitor OKL38) (Azide free) (HRP)

Sign In for Pricing
View Details
OSGIN1, CT (OSGIN1, OKL38, Oxidative stress-induced growth inhibitor 1, Ovary, kidney and liver protein 38, Pregnancy-induced growth inhibitor OKL38) (Azide free) (HRP)
MBS6329739-02 5x 0.2 mL

OSGIN1, CT (OSGIN1, OKL38, Oxidative stress-induced growth inhibitor 1, Ovary, kidney and liver protein 38, Pregnancy-induced growth inhibitor OKL38) (Azide free) (HRP)

Sign In for Pricing
View Details
Human AK4 Protein Lysate
MBS137054-01 0.02 mg

Human AK4 Protein Lysate

Sign In for Pricing
View Details