Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-2, Human (HEK293)

MMP-2 protein is a multifunctional metalloproteinase that actively participates in physiological processes such as vascular remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, it also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Human (HEK293) is the recombinant human-derived MMP-2 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

MMP-2 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-2-protein-human-hek293.html

Purity

98.0

Smiles

APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Molecular Formula

4313 (Gene_ID) P08253-1/NP_004521.1 (A30-C660) (Accession)

Molecular Weight

Approximately 72-74 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

rno-let-7f-1-3p miRNA Mimic
MBS8302933-01 5 nmol

rno-let-7f-1-3p miRNA Mimic

Ask
View Details
rno-let-7f-1-3p miRNA Mimic
MBS8302933-02 10 nmol

rno-let-7f-1-3p miRNA Mimic

Ask
View Details
rno-let-7f-1-3p miRNA Mimic
MBS8302933-03 5x 10 nmol

rno-let-7f-1-3p miRNA Mimic

Ask
View Details
NLRP12/NALP12 (NLRP12, NACHT-, LRR- and PYD-containing Protein 12, PYRIN-containing APAF1-like Protein 7, Monarch-1, Regulated by Nitric Oxide, RNO) discontinued
045086 100 µg

NLRP12/NALP12 (NLRP12, NACHT-, LRR- and PYD-containing Protein 12, PYRIN-containing APAF1-like Protein 7, Monarch-1, Regulated by Nitric Oxide, RNO) discontinued

Ask
View Details
Lentiviral mouse Rgs16 shRNA (UAS) - Lentiviral mouse Rgs16 shRNA (UAS) (100)
GTR15252486 1 Vial

Lentiviral mouse Rgs16 shRNA (UAS) - Lentiviral mouse Rgs16 shRNA (UAS) (100)

Ask
View Details
Wnt1 (Wingless-type MMTV (Mouse Mammary Tumor Virus) Integration Site Family Member) (MaxLight 405) discontinued
W3006-ML405 100 µL

Wnt1 (Wingless-type MMTV (Mouse Mammary Tumor Virus) Integration Site Family Member) (MaxLight 405) discontinued

Ask
View Details