Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-2, Human (HEK293)

MMP-2 protein is a multifunctional metalloproteinase that actively participates in physiological processes such as vascular remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, it also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Human (HEK293) is the recombinant human-derived MMP-2 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

MMP-2 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-2-protein-human-hek293.html

Purity

98.0

Smiles

APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Molecular Formula

4313 (Gene_ID) P08253-1/NP_004521.1 (A30-C660) (Accession)

Molecular Weight

Approximately 72-74 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SP100 (Nuclear Autoantigen Sp-100, Lysp100b, Nuclear Dot-associated Sp100 Protein, Speckled 100kD) (MaxLight 550)
MBS6209774-01 0.1 mL

SP100 (Nuclear Autoantigen Sp-100, Lysp100b, Nuclear Dot-associated Sp100 Protein, Speckled 100kD) (MaxLight 550)

Ask
View Details
SP100 (Nuclear Autoantigen Sp-100, Lysp100b, Nuclear Dot-associated Sp100 Protein, Speckled 100kD) (MaxLight 550)
MBS6209774-02 5x 0.1 mL

SP100 (Nuclear Autoantigen Sp-100, Lysp100b, Nuclear Dot-associated Sp100 Protein, Speckled 100kD) (MaxLight 550)

Ask
View Details
Research Grade Tirzepatide
MBS1581794-01 5 mg

Research Grade Tirzepatide

Ask
View Details
Research Grade Tirzepatide
MBS1581794-02 5x 5 mg

Research Grade Tirzepatide

Ask
View Details
HSD17B13 (NM_178135) Human Tagged ORF Clone Lentiviral Particle
RC213132L3V 200 µL

HSD17B13 (NM_178135) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details