Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGRP, Human (HEK293, His)

AGRP proteins critically regulate body weight homeostasis and feeding behavior through the central melanocortin system. As an α-melanocyte-stimulating hormone antagonist, AGRP inhibits cAMP production and antagonizes stimulation of melanocortin receptors. AGRP Protein, Human (HEK293, His) is the recombinant human-derived AGRP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AGRP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/agrp-protein-human-hek293-his.html

Purity

95.00

Smiles

AQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT

Molecular Formula

181 (Gene_ID) O00253 (A21-T132) (Accession)

Molecular Weight

Approximately 16-21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF647 conjugate, 0.1mg/mL
CD3e (B-B12), CF568 conjugate, 0.1mg/mL
BNC681052-500 1x 500 µL

CD3e (B-B12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF594 conjugate, 0.1mg/mL
BNC940333-100 1x 100 µL

CD8 (RIV11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL
BNC040017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (IGEL/773), CF647 conjugate, 0.1mg/mL
BNC470773-100 1x 100 µL

CD20 (IGEL/773), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details